Property Summary

NCBI Gene PubMed Count 16
PubMed Score 106.57
PubTator Score 41.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
adrenocortical carcinoma -2.890 0.000
aldosterone-producing adenoma -1.976 0.006

Synonym

Accession Q3LXA3 Q2L9C1 Q53EQ9 Q9BVA7 Q9H895
Symbols DAK
NET45

Gene

Gene RIF (4)

PMID Text
24569995 analysis of human triokinase/FMN cyclase reveals that kinase activity requires intact homodimers, but cyclase requires only a truncated, single domain subunit
24289155 The peptide fragment (m/z 520.3) of DAK is a promising biomarker to guide timing of antiviral treatment and to avoid liver biopsy in compensated chronic hepatitis B patients.
17600090 DAK, the physiological suppressor of cytoplasmic viral RNA sensor MDA5, specifically inhibits MDA5- but not RNA helicase RIG-I-mediated innate antiviral signaling.
16289032 Evidence supports that a single protein sustains both FMN cyclase and ATP-dependent Dha kinase activities, probably in a single active center

AA Sequence

MTSKKLVNSVAGCADDALAGLVACNPNLQLLQGHRVALRSDLDSLKGRVALLSGGGSGHEPAHAGFIGKG      1 - 70
MLTGVIAGAVFTSPAVGSILAAIRAVAQAGTVGTLLIVKNYTGDRLNFGLAREQARAEGIPVEMVVIGDD     71 - 140
SAFTVLKKAGRRGLCGTVLIHKVAGALAEAGVGLEEIAKQVNVVAKAMGTLGVSLSSCSVPGSKPTFELS    141 - 210
ADEVELGLGIHGEAGVRRIKMATADEIVKLMLDHMTNTTNASHVPVQPGSSVVMMVNNLGGLSFLELGII    211 - 280
ADATVRSLEGRGVKIARALVGTFMSALEMPGISLTLLLVDEPLLKLIDAETTAAAWPNVAAVSITGRKRS    281 - 350
RVAPAEPQEAPDSTAAGGSASKRMALVLERVCSTLLGLEEHLNALDRAAGDGDCGTTHSRAARAIQEWLK    351 - 420
EGPPPASPAQLLSKLSVLLLEKMGGSSGALYGLFLTAAAQPLKAKTSLPAWSAAMDAGLEAMQKYGKAAP    421 - 490
GDRTMLDSLWAAGQELQAWKSPGADLLQVLTKAVKSAEAAAEATKNMEAGAGRASYISSARLEQPDPGAV    491 - 560
AAAAILRAILEVLQS                                                           561 - 575
//

Text Mined References (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24569995 2014 Bifunctional homodimeric triokinase/FMN cyclase: contribution of protein domains to the activities of the human enzyme and molecular dynamics simulation of domain movements.
24289155 2013 Serum dihydroxyacetone kinase peptide m/z 520.3 as predictor of disease severity in patients with compensated chronic hepatitis B.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17600090 2007 Negative regulation of MDA5- but not RIG-I-mediated innate antiviral signaling by the dihydroxyacetone kinase.
More...