Property Summary

NCBI Gene PubMed Count 4
PubMed Score 7.14
PubTator Score 0.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
group 3 medulloblastoma 4104 1.1e-05
osteosarcoma 7950 9.8e-04
psoriasis 6694 2.3e-03
acute myeloid leukemia 783 4.7e-02

Expression

  Differential Expression (4)

Disease log2 FC p
acute myeloid leukemia -2.200 4.7e-02
group 3 medulloblastoma 1.800 1.1e-05
osteosarcoma -1.106 9.8e-04
psoriasis -1.100 2.3e-03

Synonym

Accession Q3LIE5 A8K9B4 D3DTS4 Q9BVD4 Q9NRU8
Symbols MDS006
C17orf48
NBLA03831

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MDDKPNPEALSDSSERLFSFGVIADVQFADLEDGFNFQGTRRRYYRHSLLHLQGAIEDWNNESSMPCCVL      1 - 70
QLGDIIDGYNAQYNASKKSLELVMDMFKRLKVPVHHTWGNHEFYNFSREYLTHSKLNTKFLEDQIVHHPE     71 - 140
TMPSEDYYAYHFVPFPKFRFILLDAYDLSVLGVDQSSPKYEQCMKILREHNPNTELNSPQGLSEPQFVQF    141 - 210
NGGFSQEQLNWLNEVLTFSDTNQEKVVIVSHLPIYPDASDNVCLAWNYRDALAVIWSHECVVCFFAGHTH    211 - 280
DGGYSEDPFGVYHVNLEGVIETAPDSQAFGTVHVYPDKMMLKGRGRVPDRIMNYKKERAFHC            281 - 342
//

Text Mined References (8)

PMID Year Title