Property Summary

NCBI Gene PubMed Count 2
PubMed Score 2.30
PubTator Score 3.50

Knowledge Summary

Patent

No data available

Synonym

Accession Q3LI83 Q1XDX0
Symbols KAP24.1

Gene

 GO Component (1)

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
17235325 In situ hybridization and indirect immunofluorescence microscopy studies using an antibody derived from KAP24.1 demonstrated specific expression in the middle/upper hair cuticle.

AA Sequence

MPAGSMSTTGYPGVCSTTSYRTHCYIPVTSSVTLSSSDLSPTFGHCLPSSYQGNLWLLDYCQESYGEAPT      1 - 70
CKSPSCEPKTCSTTGCDPSNSSVPCNSPSAGQVFSVCETTNVSPSPSCSPSTQTNGYVCNCHIPTRNASK     71 - 140
ACQTLRNGSNCFGQLNCLSKSFQTLNHCRLSTLGYKSYQNPCFIPSYVSPLCYISNSCQPQSYLVRNYHY    141 - 210
SSYRPTSCRPLSYLSRSFRSLSYIPSTFPPLRYLCSGSRPLKCY                              211 - 254
//

Text Mined References (2)

PMID Year Title
17235325 2007 Characterization of human KAP24.1, a cuticular hair keratin-associated protein with unusual amino-acid composition and repeat structure.
16939781 2006 Human hair keratin-associated proteins (KAPs).