Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Synonym

Accession Q3LI76 Q2M3F4
Symbols KAP15.1

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG

 HCA RNA Cell Line (1)

AA Sequence

MSYNCSSGNFSSCCFGSYLRYPVSTYNLFYPSNAIYSPNTCQLGSSLYNGCQETYCEPTSCQTSCTLARS      1 - 70
YQTSCYCPKNSIFCSPRQTNYIRSLGCGNTGLGSLGCGSTGFQSLDCGSSFYHPTTFSSRNFQATCY        71 - 137
//

Text Mined References (3)

PMID Year Title