Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MCYYHNYYGSLDYGCSYGSEYGNSGYACNFPCSYGRFLLAPRKKF                               1 - 45
//