Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.10

Knowledge Summary

Patent

No data available

Synonym

Accession Q3LHN0
Symbols KAP25.1

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MHNRSQGFFFSSCHPQNHVSYGCQSPSFIFCRCQSLNFVSRTCYPLSYFSYGNQTIGSISNSFRSLNYVS      1 - 70
HSFQPISFMHSSFQPACSDFVGWQSPFLRRTC                                           71 - 102
//

Text Mined References (1)

PMID Year Title