Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.10

Knowledge Summary

Patent

No data available

AA Sequence

MHNRSQGFFFSSCHPQNHVSYGCQSPSFIFCRCQSLNFVSRTCYPLSYFSYGNQTIGSISNSFRSLNYVS      1 - 70
HSFQPISFMHSSFQPACSDFVGWQSPFLRRTC                                           71 - 102
//

Text Mined References (1)

PMID Year Title
10830953 2000 The DNA sequence of human chromosome 21.