Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.21

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MDGVLFRAHQCQYVHPCVHVYVTVGLMDPLCERKEKASKQERENPLAHLAAWGLVGLHNIGQTCCLNSLI      1 - 70
QVFVMNVDFARILKRITVPRGADEQRRSVPFQMLLLLEKMQDSRQKAVWPLELAYCLQKYNVPLFVQHDA     71 - 140
AQLYLKLWNLIKDQIADVHLVERLQALYMIRMKDSLICLDCAMESSRNSSMLTLRLSFFDVDSKPLKTLE    141 - 210
DALHCFFQPRELSSKSKCFCENCGKKTRGKQVLKLTHLPQTLTIHLMRFSIRNSQTRKICHSLYFPQSLD    211 - 280
FSQILPMKRESCDAEEQSGGQYELFAVIAHVGMADSGHYCVYIRNAVDGKWFCFNDSNICLVSWEDIQCT    281 - 350
YGNPNYHW                                                                  351 - 358
//

Text Mined References (3)

PMID Year Title
14715245 2004 Cloning and enzymatic analysis of 22 novel human ubiquitin-specific proteases.
12838346 2003 Human and mouse proteases: a comparative genomic approach.
10591208 1999 The DNA sequence of human chromosome 22.