Property Summary

NCBI Gene PubMed Count 5
PubMed Score 5.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Breast cancer 3099 1.12208053257636E-9
atypical teratoid / rhabdoid tumor 4369 9.91163985749035E-9
sonic hedgehog group medulloblastoma 1482 1.01283183060876E-7
intraductal papillary-mucinous carcinoma (IPMC) 2988 1.15450754966246E-6
ovarian cancer 8492 1.21313011094512E-6
medulloblastoma, large-cell 6234 3.31591940473135E-6
primitive neuroectodermal tumor 3031 3.43727713675434E-6
posterior fossa group A ependymoma 1511 9.4405926958751E-6
pediatric high grade glioma 2712 3.68931844939457E-5
Atopic dermatitis 944 6.33560374698999E-5
glioblastoma 5572 1.10323526222568E-4
osteosarcoma 7933 1.36788897353753E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00176108462637125
acute myeloid leukemia 785 0.0479132005362848
Disease Target Count Z-score Confidence
Chromosome 15q13.3 microdeletion syndrome 11 4.841 2.4
Exophthalmos 16 3.065 1.5

Expression

Synonym

Accession Q3KRB8
Symbols B'-T
FAM7B1

Gene

Gene RIF (1)

PMID Text
25721503 ARHGAP11B may have contributed to evolutionary expansion of human neocortex.

AA Sequence

MWDQRLVKLALLQHLRAFYGIKVKGVRGQCDRRRHETAATEIGGKIFGVPFNALPHSAVPEYGHIPSFLV      1 - 70
DACTSLEEHIHTEGLFRKSGSVIRLKALKNKVDHGEGCLSSAPPCDIAGLLKQFFRELPEPILPADLHEA     71 - 140
LLKAQQLGTEEKNKAILLLSCLLADHTVHVLRYFFNFLRNVSLRSSENKMDSSNLAVIFAPNLLQTSEGH    141 - 210
EKMSSNAEKKGVYQTLSWKRYQPCWVLMVSVLLHHWKALKKVNMKLLVNIREREDNV                 211 - 267
//

Text Mined References (7)

PMID Year Title
25721503 2015 Human-specific gene ARHGAP11B promotes basal progenitor amplification and neocortex expansion.
23962720 2014 A genome-wide association study and biological pathway analysis of epilepsy prognosis in a prospective cohort of newly treated epilepsy.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11829490 2002 A 3-Mb map of a large Segmental duplication overlapping the alpha7-nicotinic acetylcholine receptor gene (CHRNA7) at human 15q13-q14.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.