Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.90
PubTator Score 0.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -2.000 5.5e-05
Astrocytoma, Pilocytic -1.400 2.4e-06
atypical teratoid / rhabdoid tumor -2.300 4.5e-05
ependymoma -2.200 8.5e-16
glioblastoma -2.000 1.1e-09
intraductal papillary-mucinous adenoma (... 1.400 1.2e-04
lung carcinoma 2.000 6.9e-25
medulloblastoma -1.400 3.3e-03
medulloblastoma, large-cell -2.000 2.6e-03
primitive neuroectodermal tumor -2.200 2.1e-05
psoriasis 1.100 1.3e-03
subependymal giant cell astrocytoma -1.764 4.4e-02

Gene RIF (2)

AA Sequence

MKGFKLSCTASNSNRSTPACSPILRKRSRSPTPQNQDGDTMVEKGSDHSSDKSPSTPEQGVQRSCSSQSG      1 - 70
RSGGKNSKKSQSWYNVLSPTYKQRNEDFRKLFKQLPDTERLIVDYSCALQRDILLQGRLYLSENWICFYS     71 - 140
NIFRWETLLTVRLKDICSMTKEKTARLIPNAIQVCTDSEKHFFTSFGARDRTYMMMFRLWQNALLEKPLC    141 - 210
PKELWHFVHQCYGNELGLTSDDEDYVPPDDDFNTMGYCEEIPVEENEVNDSSSKSSIETKPDASPQLPKK    211 - 280
SITNSTLTSTGSSEAPVSFDGLPLEEEALEGDGSLEKELAIDNIMGEKIEMIAPVNSPSLDFNDNEDIPT    281 - 350
ELSDSSDTHDEGEVQAFYEDLSGRQYVNEVFNFSVDKLYDLLFTNSPFQRDFMEQRRFSDIIFHPWKKEE    351 - 420
NGNQSRVILYTITLTNPLAPKTATVRETQTMYKASQESECYVIDAEVLTHDVPYHDYFYTINRYTLTRVA    421 - 490
RNKSRLRVSTELRYRKQPWGLVKTFIEKNFWSGLEDYFRHLESELAKTESTYLAEMHRQSPKEKASKTTT    491 - 560
VRRRKRPHAHLRVPHLEEVMSPVTTPTDEDVGHRIKHVAGSTQTRHIPEDTPNGFHLQSVSKLLLVISCV    561 - 630
ICFSLVLLVILNMMLFYKLWMLEYTTQTLTAWQGLRLQERLPQSQTEWAQLLESQQKYHDTELQKWREII    631 - 700
KSSVMLLDQMKDSLINLQNGIRSRDYTSESEEKRNRYH                                    701 - 738
//

Text Mined References (18)

PMID Year Title