Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.04
PubTator Score 0.95

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
20731705 Observational study of gene-disease association. (HuGE Navigator)
20332261 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKGFKLSCTASNSNRSTPACSPILRKRSRSPTPQNQDGDTMVEKGSDHSSDKSPSTPEQGVQRSCSSQSG      1 - 70
RSGGKNSKKSQSWYNVLSPTYKQRNEDFRKLFKQLPDTERLIVDYSCALQRDILLQGRLYLSENWICFYS     71 - 140
NIFRWETLLTVRLKDICSMTKEKTARLIPNAIQVCTDSEKHFFTSFGARDRTYMMMFRLWQNALLEKPLC    141 - 210
PKELWHFVHQCYGNELGLTSDDEDYVPPDDDFNTMGYCEEIPVEENEVNDSSSKSSIETKPDASPQLPKK    211 - 280
SITNSTLTSTGSSEAPVSFDGLPLEEEALEGDGSLEKELAIDNIMGEKIEMIAPVNSPSLDFNDNEDIPT    281 - 350
ELSDSSDTHDEGEVQAFYEDLSGRQYVNEVFNFSVDKLYDLLFTNSPFQRDFMEQRRFSDIIFHPWKKEE    351 - 420
NGNQSRVILYTITLTNPLAPKTATVRETQTMYKASQESECYVIDAEVLTHDVPYHDYFYTINRYTLTRVA    421 - 490
RNKSRLRVSTELRYRKQPWGLVKTFIEKNFWSGLEDYFRHLESELAKTESTYLAEMHRQSPKEKASKTTT    491 - 560
VRRRKRPHAHLRVPHLEEVMSPVTTPTDEDVGHRIKHVAGSTQTRHIPEDTPNGFHLQSVSKLLLVISCV    561 - 630
ICFSLVLLVILNMMLFYKLWMLEYTTQTLTAWQGLRLQERLPQSQTEWAQLLESQQKYHDTELQKWREII    631 - 700
KSSVMLLDQMKDSLINLQNGIRSRDYTSESEEKRNRYH                                    701 - 738
//

Publication (18)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24292274 2014 A genome-wide association study identifies multiple susceptibility loci for chronic lymphocytic leukemia.
23770605 2013 Genome-wide association study identifies multiple risk loci for chronic lymphocytic leukemia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22700719 2012 Common variation at 6p21.31 (BAK1) influences the risk of chronic lymphocytic leukemia.
20731705 2010 Genetic susceptibility for chronic lymphocytic leukemia among Chinese in Hong Kong.
20639881 2010 Genome-wide association study of follicular lymphoma identifies a risk locus at 6p21.32.
20332261 2010 Genetic susceptibility variants for chronic lymphocytic leukemia.
19946888 2010 Defining the membrane proteome of NK cells.
18758461 2008 A genome-wide association study identifies six susceptibility loci for chronic lymphocytic leukemia.
More...