Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.94
PubTator Score 6.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ulcerative colitis 1819 7.1e-06
Multiple Sclerosis 540 1.4e-03
interstitial cystitis 2312 3.5e-03
active Crohn's disease 922 1.4e-02
spina bifida 1074 3.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Retinitis pigmentosa 11 59 3.327 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
active Crohn's disease -1.180 1.4e-02
interstitial cystitis -1.400 3.5e-03
Multiple Sclerosis 1.200 1.4e-03
spina bifida -1.085 3.6e-02
ulcerative colitis -1.600 7.1e-06

Gene RIF (6)

AA Sequence

MKAFGPPHEGPLQGLVASRIETYGGRHRASAQSTAGRLYPRGYPVLDPSRRRLQQYVPFARGSGQARGLS      1 - 70
PMRLRDPEPEKRHGGHVGAGLLHSPKLKELTKAHELEVRLHTFSMFGMPRLPPEDRRHWEIGEGGDSGLT     71 - 140
IEKSWRELVPGHKEMSQELCHQQEALWELLTTELIYVRKLKIMTDLLAAGLLNLQRVGLLMEVSAETLFG    141 - 210
NVPSLIRTHRSFWDEVLGPTLEETRASGQPLDPIGLQSGFLTFGQRFHPYVQYCLRVKQTMAYAREQQET    211 - 280
NPLFHAFVQWCEKHKRSGRQMLCDLLIKPHQRITKYPLLLHAVLKRSPEARAQEALNAMIEAVESFLRHI    281 - 350
NGQVRQGEEQESLAAAAQRIGPYEVLEPPSDEVEKNLRPFSTLDLTSPMLGVASEHTRQLLLEGPVRVKE    351 - 420
GREGKLDVYLFLFSDVLLVTKPQRKADKAKVIRPPLMLEKLVCQPLRDPNSFLLIHLTEFQCVSSALLVH    421 - 490
CPSPTDRAQWLEKTQQAQAALQKLKAEEYVQQKRELLTLYRDQDRESPSTRPSTPSLEGSQSSAEGRTPE    491 - 560
FSTIIPHLVVTEDTDEDAPLVPDDTSDSGYGTLIPGTPTGSRSPLSRLRQRALRRDPRLTFSTLELRDIP    561 - 630
LRPHPPDPQAPQRRSAPELPEGILKGGSLPQEDPPTWSEEEDGASERGNVVVETLHRARLRGQLPSSPTH    631 - 700
ADSAGESPWESSGEEEEEGPLFLKAGHTSLRPMRAEDMLREIREELASQRIEGAEEPRDSRPRKLTRAQL    701 - 770
QRMRGPHIIQLDTPLSASEV                                                      771 - 790
//

Text Mined References (16)

PMID Year Title