Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.59
PubTator Score 0.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.2e-11
medulloblastoma, large-cell 6241 2.7e-04

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.100 2.7e-04
ovarian cancer 1.700 1.2e-11

Gene RIF (2)

AA Sequence

MDFLMSGLAACGACVFTNPLEVVKTRMQLQGELQAPGTYQRHYRNVFHAFITIGKVDGLAALQKGLAPAL      1 - 70
LYQFLMNGIRLGTYGLAEAGGYLHTAEGTHSPARSAAAGAMAGVMGAYLGSPIYMVKTHLQAQAASEIAV     71 - 140
GHQYKHQGMFQALTEIGQKHGLVGLWRGALGGLPRVIVGSSTQLCTFSSTKDLLSQWEIFPPQSWKLALV    141 - 210
AAMMSGIAVVLAMAPFDVACTRLYNQPTDAQGKGLMYRGILDALLQTARTEGIFGMYKGIGASYFRLGPH    211 - 280
TILSLFFWDQLRSLYYTDTK                                                      281 - 300
//

Text Mined References (7)

PMID Year Title