Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.45
PubTator Score 0.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 0.00132237409948615
group 3 medulloblastoma 2254 0.00230674485719404
Disease Target Count Z-score Confidence
Schizophrenia 503 0.0 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.697 0.001
group 3 medulloblastoma 2.400 0.002

Synonym

Accession Q3KPI0 B7WNQ6 O75296 Q6UY47 Q96ER7
Symbols CEACAM3
R29124_1

Gene

  Ortholog (1)

Species Source
Rat OMA Inparanoid

Gene RIF (1)

PMID Text
21682944 This study revealed CEACAM21 as novel schizophrenia candidate genes in the Jewish population

AA Sequence

MGPPSACPHRECIPWQGLLLTASLLTFWNAPTTAWLFIASAPFEVAEGENVHLSVVYLPENLYSYGWYKG      1 - 70
KTVEPNQLIAAYVIDTHVRTPGPAYSGRETISPSGDLHFQNVTLEDTGYYTLQVTYRNSQIEQASHHLRV     71 - 140
YESVAQPSIQASSTTVTEKGSVVLTCHTNNTGTSFQWIFNNQRLQVTKRMKLSWFNHMLTIDPIRQEDAG    141 - 210
EYQCEVSNPVSSNRSDPLKLTVKSDDNTLGILIGVLVGSLLVAALVCFLLLRKTGRASDQSDFREQQPPA    211 - 280
STPGHGPSDSSIS                                                             281 - 293
//

Text Mined References (7)

PMID Year Title
23065704 2013 A meta-analysis of genome-wide association studies to identify prostate cancer susceptibility loci associated with aggressive and non-aggressive disease.
21682944 2012 DOCK4 and CEACAM21 as novel schizophrenia candidate genes in the Jewish population.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.