Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.45
PubTator Score 0.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 1.3e-03
group 3 medulloblastoma 4104 2.3e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Schizophrenia 1160 0.0 2.7

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 2.400 2.3e-03
osteosarcoma -1.697 1.3e-03

Gene RIF (1)

AA Sequence

MGPPSACPHRECIPWQGLLLTASLLTFWNAPTTAWLFIASAPFEVAEGENVHLSVVYLPENLYSYGWYKG      1 - 70
KTVEPNQLIAAYVIDTHVRTPGPAYSGRETISPSGDLHFQNVTLEDTGYYTLQVTYRNSQIEQASHHLRV     71 - 140
YESVAQPSIQASSTTVTEKGSVVLTCHTNNTGTSFQWIFNNQRLQVTKRMKLSWFNHMLTIDPIRQEDAG    141 - 210
EYQCEVSNPVSSNRSDPLKLTVKSDDNTLGILIGVLVGSLLVAALVCFLLLRKTGRASDQSDFREQQPPA    211 - 280
STPGHGPSDSSIS                                                             281 - 293
//

Text Mined References (7)

PMID Year Title