Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.76
PubTator Score 0.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
adult high grade glioma 1.600 1.8e-03
astrocytic glioma 1.100 3.2e-03
Astrocytoma, Pilocytic 3.100 9.5e-09
atypical teratoid/rhabdoid tumor 1.300 5.8e-05
cystic fibrosis -1.352 8.5e-05
ductal carcinoma in situ 2.900 3.7e-03
glioblastoma 2.400 9.9e-08
interstitial cystitis -2.300 2.6e-02
intraductal papillary-mucinous adenoma (... 3.000 1.4e-04
intraductal papillary-mucinous carcinoma... 3.200 3.4e-04
intraductal papillary-mucinous neoplasm ... 3.400 1.4e-03
invasive ductal carcinoma 2.300 4.7e-03
lung adenocarcinoma 1.700 1.2e-06
lung cancer -1.700 5.8e-04
malignant mesothelioma 1.100 2.5e-04
nasopharyngeal carcinoma -1.100 6.2e-04
nephrosclerosis -1.152 5.7e-03
non-small cell lung cancer 2.173 9.0e-24
oligodendroglioma 1.200 1.7e-02
osteosarcoma -1.821 2.4e-03
ovarian cancer 2.900 6.1e-09
pancreatic cancer 1.800 2.4e-06
pancreatic ductal adenocarcinoma liver m... 2.793 2.6e-02
primitive neuroectodermal tumor 1.900 4.1e-03
spina bifida -1.849 2.9e-02

Gene RIF (2)

AA Sequence

MLQMPKLNEIPPGRAGRREARGEGRWPGQTGPEAARLEWRAQGQAGGARAPWDSWGSSRLPTQPGPGWSR      1 - 70
CPPSLLCALSFQKSTMESKDEVSDTDSGIILQSGPDSPVSPMKELTHAVHKQQRALEARLEACLEELRRL     71 - 140
CLREAELTGTLPAEYPLKPGEKAPKVRRRIGAAYKLDDWALHREDPLSSLERQLALQLQITEAARRLCLE    141 - 210
ENLSRQARRQRKHSMLQEEKKLQELQRCLVERRRNSEPPPAAALPLGRELSASDDSSLSDGLLLEEEESQ    211 - 280
VPKPPPESPAPPSRPLPPQTLEGLQPTGPEAGSPERAPVQNSPWKETSLDHPYEKPRKSSEPWSESSSPA    281 - 350
TTPQDGPSASSLWLLEPASYHVVPIRGVPGQWQGRTSAPATPEIQGRRGQSQSLRVDSFRAGPEGRGRSA    351 - 420
FPRRRPTHYTVTVPDSCFPATKPPLPHAACHSCSEDSGSDVSSISHPTSPGSSSPDISFLQPLSPPKTHR    421 - 490
HRGAWVPAGSRELVAHHPKLLLPPGYFPAGRYVVVAESPLPPGEWELRRAAPGPAYEEEGTPLRYQRLVP    491 - 560
SRSRIVRTPSLKDSPAGRGLSKAAVSEELKWWHERARLRSTRPHSLDRQGAFRVRSLPLGREGFGRALGP    561 - 630
RAQVPTVCVLRRSPDGAPVQVFVPEKGEIISQV                                         631 - 663
//

Text Mined References (14)

PMID Year Title