Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.76
PubTator Score 0.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
non-small cell lung cancer 2798 9.0420585187226E-24
ovarian cancer 8492 6.14525826352079E-9
pilocytic astrocytoma 3086 1.16134437578787E-8
glioblastoma 5572 9.92567406176646E-8
lung adenocarcinoma 2714 1.21906175510971E-6
pancreatic cancer 2300 2.4347776806314E-6
atypical teratoid/rhabdoid tumor 1095 5.80101864516137E-5
cystic fibrosis 1670 8.49315078038488E-5
interstitial cystitis 2299 9.35317521611113E-5
pediatric high grade glioma 2712 9.76991229008915E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 1.42709982160334E-4
malignant mesothelioma 3163 2.48862831944077E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.40526224985226E-4
lung cancer 4473 5.77235000712263E-4
nasopharyngeal carcinoma 1056 6.21797977971508E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00144220911593977
osteosarcoma 7933 0.00239876902594655
astrocytic glioma 2241 0.00323028821322094
ductal carcinoma in situ 1745 0.00370492750161536
primitive neuroectodermal tumor 3031 0.00405181490237044
invasive ductal carcinoma 2950 0.00472348425959639
nephrosclerosis 329 0.00566425758445346
oligodendroglioma 2849 0.0170714612188754
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0258495376367133
spina bifida 1064 0.0294440173606223
Disease Target Count Z-score Confidence
Celiac disease 112 0.0 2.0
Crohn's disease 304 0.0 2.0
ulcerative colitis 2087 0.0 1.0
Disease Target Count Z-score Confidence
Large cell carcinoma 7 3.146 1.6
Lung large cell carcinoma 7 3.146 1.6

Expression

Synonym

Accession Q3KP66 B4E1K9 E9PFY0 Q9NV65 Q9NVI0
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MLQMPKLNEIPPGRAGRREARGEGRWPGQTGPEAARLEWRAQGQAGGARAPWDSWGSSRLPTQPGPGWSR      1 - 70
CPPSLLCALSFQKSTMESKDEVSDTDSGIILQSGPDSPVSPMKELTHAVHKQQRALEARLEACLEELRRL     71 - 140
CLREAELTGTLPAEYPLKPGEKAPKVRRRIGAAYKLDDWALHREDPLSSLERQLALQLQITEAARRLCLE    141 - 210
ENLSRQARRQRKHSMLQEEKKLQELQRCLVERRRNSEPPPAAALPLGRELSASDDSSLSDGLLLEEEESQ    211 - 280
VPKPPPESPAPPSRPLPPQTLEGLQPTGPEAGSPERAPVQNSPWKETSLDHPYEKPRKSSEPWSESSSPA    281 - 350
TTPQDGPSASSLWLLEPASYHVVPIRGVPGQWQGRTSAPATPEIQGRRGQSQSLRVDSFRAGPEGRGRSA    351 - 420
FPRRRPTHYTVTVPDSCFPATKPPLPHAACHSCSEDSGSDVSSISHPTSPGSSSPDISFLQPLSPPKTHR    421 - 490
HRGAWVPAGSRELVAHHPKLLLPPGYFPAGRYVVVAESPLPPGEWELRRAAPGPAYEEEGTPLRYQRLVP    491 - 560
SRSRIVRTPSLKDSPAGRGLSKAAVSEELKWWHERARLRSTRPHSLDRQGAFRVRSLPLGREGFGRALGP    561 - 630
RAQVPTVCVLRRSPDGAPVQVFVPEKGEIISQV                                         631 - 663
//

Text Mined References (12)

PMID Year Title
25082827 2014 A genome-wide association study identifies a novel locus at 6q22.1 associated with ulcerative colitis.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
19915572 2009 Genome-wide association study of ulcerative colitis identifies three new susceptibility loci, including the HNF4A region.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
More...