Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 3.3e-06
ovarian cancer 8520 6.4e-04
acute myeloid leukemia 783 7.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Kidney cancer 2613 0.0 0.5

Expression

  Differential Expression (3)

Disease log2 FC p
acute myeloid leukemia 2.000 7.1e-03
osteosarcoma 1.858 3.3e-06
ovarian cancer -1.200 6.4e-04

Gene RIF (1)

AA Sequence

MDSVAFEDVSVSFSQEEWALLAPSQKKLYRDVMQETFKNLASIGEKWEDPNVEDQHKNQGRNLRSHTGER      1 - 70
LCEGKEGSQCAENFSPNLSVTKKTAGVKPYECTICGKAFMRLSSLTRHMRSHTGYELFEKPYKCKECEKA     71 - 140
FSYLKSFQRHERSHTGEKPYKCKQCGKTFIYHQPFQRHERTHIGEKPYECKQCGKALSCSSSLRVHERIH    141 - 210
TGEKPYECKQCGKAFSCSSSIRVHERTHTGEKPYACKECGKAFISHTSVLTHMITHNGDRPYKCKECGKA    211 - 280
FIFPSFLRVHERIHTGEKPYKCKQCGKAFRCSTSIQIHERIHTGEKPYKCKECGKSFSARPAFRVHVRVH    281 - 350
TGEKPYKCKECGKAFSRISYFRIHERTHTGEKPYECKKCGKTFNYPLDLKIHKRNHTGEKPYECKECAKT    351 - 420
FISLENFRRHMITHTGDGPYKCRDCGKVFIFPSALRTHERTHTGEKPYECKQCGKAFSCSSYIRIHKRTH    421 - 490
TGEKPYECKECGKAFIYPTSFQGHMRMHTGEKPYKCKECGKAFSLHSSFQRHTRIHNYEKPLECKQCGKA    491 - 560
FSVSTSLKKHMRMHNR                                                          561 - 576
//

Text Mined References (5)

PMID Year Title