Property Summary

NCBI Gene PubMed Count 4
PubMed Score 11.21
PubTator Score 6.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 0.8
Disease Target Count Z-score Confidence
Sertoli cell-only syndrome 37 3.908 2.0

Expression

AA Sequence

MRANCSSSSACPANSSEEELPVGLEVHGNLELVFTVVSTVMMGLLMFSLGCSVEIRKLWSHIRRPWGIAV      1 - 70
GLLCQFGLMPFTAYLLAISFSLKPVQAIAVLIMGCCPGGTISNIFTFWVDGDMDLSISMTTCSTVAALGM     71 - 140
MPLCIYLYTWSWSLQQNLTIPYQNIGITLVCLTIPVAFGVYVNYRWPKQSKIILKIGAVVGGVLLLVVAV    141 - 210
AGVVLAKGSWNSDITLLTISFIFPLIGHVTGFLLALFTHQSWQRCRTISLETGAQNIQMCITMLQLSFTA    211 - 280
EHLVQMLSFPLAYGLFQLIDGFLIVAAYQTYKRRLKNKHGKKNSGCTEVCHTRKSTSSRETNAFLEVNEE    281 - 350
GAITPGPPGPMDCHRALEPVGHITSCE                                               351 - 377
//

Text Mined References (5)

PMID Year Title