Property Summary

NCBI Gene PubMed Count 4
PubMed Score 7.32
PubTator Score 6.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Sertoli cell-only syndrome 36 3.95 2.0

Expression

Synonym

Accession Q3KNW5 Q70EX7
Symbols SOAT

Gene

PANTHER Protein Class (2)

AA Sequence

MRANCSSSSACPANSSEEELPVGLEVHGNLELVFTVVSTVMMGLLMFSLGCSVEIRKLWSHIRRPWGIAV      1 - 70
GLLCQFGLMPFTAYLLAISFSLKPVQAIAVLIMGCCPGGTISNIFTFWVDGDMDLSISMTTCSTVAALGM     71 - 140
MPLCIYLYTWSWSLQQNLTIPYQNIGITLVCLTIPVAFGVYVNYRWPKQSKIILKIGAVVGGVLLLVVAV    141 - 210
AGVVLAKGSWNSDITLLTISFIFPLIGHVTGFLLALFTHQSWQRCRTISLETGAQNIQMCITMLQLSFTA    211 - 280
EHLVQMLSFPLAYGLFQLIDGFLIVAAYQTYKRRLKNKHGKKNSGCTEVCHTRKSTSSRETNAFLEVNEE    281 - 350
GAITPGPPGPMDCHRALEPVGHITSCE                                               351 - 377
//

Text Mined References (5)

PMID Year Title
22791750 2012 Genome-wide association study identifies novel loci association with fasting insulin and insulin resistance in African Americans.
17491011 2007 Cloning and functional characterization of human sodium-dependent organic anion transporter (SLC10A6).
16541252 2006 The solute carrier family SLC10: more than a family of bile acid transporters regarding function and phylogenetic relationships.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.