Property Summary

NCBI Gene PubMed Count 4
PubMed Score 7.32
PubTator Score 6.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count Z-score Confidence
Sertoli cell-only syndrome 36 3.95 2.0

Expression

Synonym

Accession Q3KNW5 Q70EX7
Symbols SOAT

Gene

PANTHER Protein Class (2)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Xenopus OMA EggNOG

 GWAS Trait (1)

AA Sequence

MRANCSSSSACPANSSEEELPVGLEVHGNLELVFTVVSTVMMGLLMFSLGCSVEIRKLWSHIRRPWGIAV      1 - 70
GLLCQFGLMPFTAYLLAISFSLKPVQAIAVLIMGCCPGGTISNIFTFWVDGDMDLSISMTTCSTVAALGM     71 - 140
MPLCIYLYTWSWSLQQNLTIPYQNIGITLVCLTIPVAFGVYVNYRWPKQSKIILKIGAVVGGVLLLVVAV    141 - 210
AGVVLAKGSWNSDITLLTISFIFPLIGHVTGFLLALFTHQSWQRCRTISLETGAQNIQMCITMLQLSFTA    211 - 280
EHLVQMLSFPLAYGLFQLIDGFLIVAAYQTYKRRLKNKHGKKNSGCTEVCHTRKSTSSRETNAFLEVNEE    281 - 350
GAITPGPPGPMDCHRALEPVGHITSCE                                               351 - 377
//

Text Mined References (5)

PMID Year Title
22791750 2012 Genome-wide association study identifies novel loci association with fasting insulin and insulin resistance in African Americans.
17491011 2007 Cloning and functional characterization of human sodium-dependent organic anion transporter (SLC10A6).
16541252 2006 The solute carrier family SLC10: more than a family of bile acid transporters regarding function and phylogenetic relationships.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.