Property Summary

NCBI Gene PubMed Count 3
Grant Count 6
R01 Count 6
Funding $349,123.2
PubMed Score 8.64
PubTator Score 8.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
tuberculosis and treatment for 6 months -1.100 0.000

Synonym

Accession Q3KNW1 Q86SU5
Symbols SMUC
SNAIL3
ZNF293
Zfp293

Gene

Gene RIF (1)

PMID Text
24638100 SNAI1, SNAI2, SNAI3 show unequal oncogenic potential, strictly correlating with their ability to promote epithelial-to-mesenchymal transition.

AA Sequence

MPRSFLVKTHSSHRVPNYRRLETQREINGACSACGGLVVPLLPRDKEAPSVPGDLPQPWDRSSAVACISL      1 - 70
PLLPRIEEALGASGLDALEVSEVDPRASRAAIVPLKDSLNHLNLPPLLVLPTRWSPTLGPDRHGAPEKLL     71 - 140
GAERMPRAPGGFECFHCHKPYHTLAGLARHRQLHCHLQVGRVFTCKYCDKEYTSLGALKMHIRTHTLPCT    141 - 210
CKICGKAFSRPWLLQGHVRTHTGEKPYACSHCSRAFADRSNLRAHLQTHSDAKKYRCRRCTKTFSRMSLL    211 - 280
ARHEESGCCPGP                                                              281 - 292
//

Text Mined References (4)

PMID Year Title
24638100 2014 Snail family members unequally trigger EMT and thereby differ in their ability to promote the neoplastic transformation of mammary epithelial cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12579345 2003 Identification and characterization of human SNAIL3 (SNAI3) gene in silico.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.