Property Summary

NCBI Gene PubMed Count 3
PubMed Score 9.05
PubTator Score 8.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Enterocolitis, Necrotizing 17 0.0 0.0
Disease Target Count
Necrotizing Enterocolitis 17
Disease Target Count P-value
tuberculosis and treatment for 6 months 409 1.9e-05

Expression

  Differential Expression (1)

Disease log2 FC p
tuberculosis and treatment for 6 months -1.100 1.9e-05

Gene RIF (1)

AA Sequence

MPRSFLVKTHSSHRVPNYRRLETQREINGACSACGGLVVPLLPRDKEAPSVPGDLPQPWDRSSAVACISL      1 - 70
PLLPRIEEALGASGLDALEVSEVDPRASRAAIVPLKDSLNHLNLPPLLVLPTRWSPTLGPDRHGAPEKLL     71 - 140
GAERMPRAPGGFECFHCHKPYHTLAGLARHRQLHCHLQVGRVFTCKYCDKEYTSLGALKMHIRTHTLPCT    141 - 210
CKICGKAFSRPWLLQGHVRTHTGEKPYACSHCSRAFADRSNLRAHLQTHSDAKKYRCRRCTKTFSRMSLL    211 - 280
ARHEESGCCPGP                                                              281 - 292
//

Text Mined References (4)

PMID Year Title