Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.97
PubTator Score 2.09

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MLTRKIKLWDINAHITCRLCSGYLIDATTVTECLHTFCRSCLVKYLEENNTCPTCRIVIHQSHPLQYIGH      1 - 70
DRTMQDIVYKLVPGLQEAEMRKQREFYHKLGMEVPGDIKGETCSAKQHLDSHRNGETKADDSSNKEAAEE     71 - 140
KPEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIRCSAQATVLHLKKFIAKKLNLSSFNELDILCNEEIL    141 - 210
GKDHTLKFVVVTRWRFKKAPLLLHYRPKMDLL                                          211 - 242
//

Text Mined References (11)

PMID Year Title