Property Summary

NCBI Gene PubMed Count 9
Grant Count 2
Funding $5,953
PubMed Score 0.63
PubTator Score 2.09

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q3KNV8 D3DVN1 O15262
Symbols RNF3
DONG1
RNF3A

Gene

PANTHER Protein Class (2)

 Grant Application (2)

AA Sequence

MLTRKIKLWDINAHITCRLCSGYLIDATTVTECLHTFCRSCLVKYLEENNTCPTCRIVIHQSHPLQYIGH      1 - 70
DRTMQDIVYKLVPGLQEAEMRKQREFYHKLGMEVPGDIKGETCSAKQHLDSHRNGETKADDSSNKEAAEE     71 - 140
KPEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIRCSAQATVLHLKKFIAKKLNLSSFNELDILCNEEIL    141 - 210
GKDHTLKFVVVTRWRFKKAPLLLHYRPKMDLL                                          211 - 242
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22493164 2012 Systematic analysis of dimeric E3-RING interactions reveals increased combinatorial complexity in human ubiquitination networks.
22443383 2012 Genome wide association study for plasma levels of natural anticoagulant inhibitors and protein C anticoagulant pathway: the MARTHA project.
21282530 2011 Interaction proteomics analysis of polycomb proteins defines distinct PRC1 complexes in mammalian cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.