Knowledge Summary

Patent

No data available

Synonym

Accession Q3C1V9 A6NNX0
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MTPPPPSPLLGTQVKEDRADYKEFQDFSSLPDTHNIAWDHSFYPFQEEEEHGVKGVESVLEKGVLDEGVL      1 - 70
EAWGCCRRCRHAGWNRSQPSPELAGAVIHARAPAVGCRQRSGHLHVRLKQRLLERPCQEPLGKKYQLELP     71 - 140
PLYERARKPEGSKNLPADGQGLRAVRADAALPVWPGGPGRPGPHAPEAGAEGQHQGQWPPADTRHLRTPK    141 - 210
WPYKVATEEKPEAEEAEKKRQAKVQEKRLPPWKKRTLNQVHRVPWGQHRACQVMLLVSTKQLQRYLHFEK    211 - 280
PAKPANMGQDPDCFGKSEGELATCLCGGESVVGETEAPGVRPDPRPEKDAKPAVSGCQEESWLQSEYDEM    281 - 350
HPREEMNVPSLRSGSGCQVSGSPLAKGLHPLQPCHPHYMMWECCLFTLTLGTQACFEVCARRLKLAHFCP    351 - 420
DTSLWSCGGQSPPVLCQLLDIISVSRDKVIGSHEKKPSSNPNQDDFHSSEYAYRCGIAEAVGLPSIPVHP    421 - 490
IGYYDAEKLLEYESLLLQVSEPVNPELSAGPITGLLDRLSGFRDHGPPGSSCRSQRKGNGVETKDQAHRN    491 - 560
RDPRGFQGGVLTARLFKMQVSLELFCGHQEHYLTRPVLAPGYPVHLGKAGTHWEQGPNMPTPEQHGTWGN    561 - 630
RHLFAVLPLLFYTSLEIMSIGYSVVMAGRNVWQPTKGQMPHQPEQSCQTLALPMTIRHSWEGGAIRESSG    631 - 700
WVSWKCHLKATEASQNPCVRATALRVGCSAVTYGVLGQAQGSAPWTSAFKTFSAGIAGLERHAWETM       701 - 767
//

Text Mined References (1)

PMID Year Title
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.