Property Summary

NCBI Gene PubMed Count 6
Grant Count 5
Funding $1,600,314
PubMed Score 56.71
PubTator Score 6.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Limb ischemia 12 4.463 2.2

Gene RIF (1)

PMID Text
18855024 Data suggest that BSX is essential for global cognitive function and that haplo-insufficiency may cause severe mental retardation, and that deletion of Neurogranin

AA Sequence

MNLNFTSPLHPASSQRPTSFFIEDILLHKPKPLREVAPDHFASSLASRVPLLDYGYPLMPTPTLLAPHAH      1 - 70
HPLHKGDHHHPYFLTTSGMPVPALFPHPQHAELPGKHCRRRKARTVFSDSQLSGLEKRFEIQRYLSTPER     71 - 140
VELATALSLSETQVKTWFQNRRMKHKKQLRKSQDEPKAPDGPESPEGSPRGSEAATAAEARLSLPAGPFV    141 - 210
LTEPEDEVDIGDEGELGSGPHVL                                                   211 - 233
//

Text Mined References (7)

PMID Year Title
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
18855024 2009 Chromosomal microarray mapping suggests a role for BSX and Neurogranin in neurocognitive and behavioral defects in the 11q terminal deletion disorder (Jacobsen syndrome).
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353277 2007 Cloning and functional analysis of hypothalamic homeobox gene Bsx1a and its isoform, Bsx1b.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
14678827 2004 Bsx, an evolutionary conserved Brain Specific homeoboX gene expressed in the septum, epiphysis, mammillary bodies and arcuate nucleus.