Property Summary

NCBI Gene PubMed Count 6
PubMed Score 59.56
PubTator Score 6.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Limb ischemia 15 4.726 2.4

Gene RIF (1)

AA Sequence

MNLNFTSPLHPASSQRPTSFFIEDILLHKPKPLREVAPDHFASSLASRVPLLDYGYPLMPTPTLLAPHAH      1 - 70
HPLHKGDHHHPYFLTTSGMPVPALFPHPQHAELPGKHCRRRKARTVFSDSQLSGLEKRFEIQRYLSTPER     71 - 140
VELATALSLSETQVKTWFQNRRMKHKKQLRKSQDEPKAPDGPESPEGSPRGSEAATAAEARLSLPAGPFV    141 - 210
LTEPEDEVDIGDEGELGSGPHVL                                                   211 - 233
//

Text Mined References (7)

PMID Year Title