Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 6.3e-15

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -3.200 6.3e-15

AA Sequence

MTEQVIGANSVPGIIAPDNVHVIQPSNPVASGNHLQPSEVTTYPISPKVIHCDTGRANLQNLLVVNQNSA      1 - 70
AGVQSQPIGYQRQYPVGTASLQTVPGVIQYTQGTTNLQTWPGDLQNPLNANPGLTHTSNSSQWNTSFASF     71 - 140
TSFNPKKFINEEVRTLGAIQILIGLTHIFSAINPVLYYYPFVTWLSGYPLWGGLSYIVSGSLSVWAAKDP    141 - 210
SPCVVNSSISFNIISALFAFAGIFIIITDLSLYYVTTYSKAVSGGLLPFALLEFILTCVVSHFGCQATCC    211 - 280
RQFENVAVIPTVFSFNPANTTTSPVNATTGPVNAATGPVSATN                               281 - 323
//

Text Mined References (1)

PMID Year Title