Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q3BBV2
Symbols NBPF8P

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MVVSAGPWSSEKAEMNILEINEKLRPQLAENKQQFVNLKEMFSNSTGRLPGQPTEEIQQYKVLVHSQERE      1 - 70
LTQLKEKLREGRDASRSLNEHLQALLTLDEPDKSQGQDLQEQLAEGCRLAQHLVQKLSPENDEDEDEDVQ     71 - 140
VEEDEKVLESSAPREVQKAEESKVPEDSLEECAITCSNSHGPCDSIQPHKNIKITFEEDKVNSSLVVDRE    141 - 210
SSHDGCQDALNILPVPGPTSSATNVSMVVSAGPLSSEKAEMNILEINEKLCPQLAEKKQQFRSLKEKCFV    211 - 280
TQVACFLAKQQNKYKYEECKDLIKSMLRNERQFKEEKLAEQLKQAEELRQYKVLVHSQERELTQLREKLR    281 - 350
EGRDASRSLNEHLQALLTPDEPDKSQGQDLQEQLAEGCRLAQHLVQKLSPENDNDDDEDVQVEVAEKVQK    351 - 420
SSSPREMQKAEEKEVPEDSLEECAITCSNSHGPYDSNQPHRKTKITFEEDKVDSTLIGSSSHVEWEDAVH    421 - 490
IIPENESDDEEEEEKGPVSPRNLQESEEEEVPQESWDEGYSTLSIPPERLASYQSYSSTFHSLEEQQVCM    491 - 560
AVDIGRHRWDQVKKEDQEATGPRLSRELLDEKGPEVLQDSLDRCYSTPSGCLELTDSCQPYRSAFYILEQ    561 - 630
QRVGLAVDMDEIEKYQEVEEDQDPSCPRLSRELLDEKEPEVLQDSLDRCYSTPSGYLELPDLGQPYSSAV    631 - 700
YSLEEQYLGLALDVDRIKKDQEEEEDQGPPCPRLSRELLEVVEPEVLQDSLDRCYSTPSSCLEQPDSCQP    701 - 770
YGSSFYALEEKHVGFSLDVGEIEKKGKGKIGRGRRSKKKRRRGRKEGEEDQNPPCPRLNSVLMEVEEPEV    771 - 840
LQDSLDRCYSTPSMYCELRDSFQHYRSVF                                             841 - 869
//

Text Mined References (5)

PMID Year Title
22973535 2012 Evolutionary history and genome organization of DUF1220 protein domains.
22901949 2012 DUF1220-domain copy number implicated in human brain-size pathology and evolution.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16079250 2005 A novel gene family NBPF: intricate structure generated by gene duplications during primate evolution.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.