Property Summary

NCBI Gene PubMed Count 4
PubMed Score 7.14
PubTator Score 1.62

Knowledge Summary


No data available


  Disease Sources (1)



Accession Q3B8N5 C9J5W1 Q8N9Q3
Symbols PROX-2


  Ortholog (6)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Anole lizard OMA Inparanoid

AA Sequence

DSDPSWKKPIYKIISKLDSDIPEIFKSSSYPQ                                          561 - 592

Text Mined References (7)

PMID Year Title
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
21490707 2011 Genome-wide meta-analysis identifies regions on 7p21 (AHR) and 15q24 (CYP1A2) as determinants of habitual caffeine consumption.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.