Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.50
PubTator Score 0.53

Knowledge Summary


No data available


  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 3.5e-08
Disease Target Count Z-score Confidence
Attention deficit hyperactivity disorder 278 0.0 1.0
Gout 104 0.0 1.4
Disease Target Count Z-score Confidence
Endogenous depression 8 3.91 2.0

AA Sequence

IQGVSEDWKRANSIFRNFLRLKSSRNTAEAE                                            71 - 101

Text Mined References (4)

PMID Year Title