Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.50
PubTator Score 0.53

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count P-value
ovarian cancer 8492 3.53009273054373E-8
Disease Target Count Z-score Confidence
Gout 93 0.0 1.0
Disease Target Count Z-score Confidence
Endogenous depression 4 3.923 2.0

AA Sequence

IQGVSEDWKRANSIFRNFLRLKSSRNTAEAE                                            71 - 101

Text Mined References (4)

PMID Year Title
24532677 2015 A genome-wide association study of rheumatoid arthritis without antibodies against citrullinated peptides.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.