Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.75
PubTator Score 2.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 1.61185224528508E-6
glioblastoma 5572 6.00539268349414E-5
adult high grade glioma 2148 7.8178879478365E-4
medulloblastoma, large-cell 6234 0.0027571335148724
psoriasis 6685 0.00291575635271132
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00450567172212533
subependymal giant cell astrocytoma 2287 0.0190464366275008
spina bifida 1064 0.040058767532653
Disease Target Count Z-score Confidence
Cardiovascular system disease 194 0.0 2.0

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis 1.300 0.003
osteosarcoma -1.193 0.000
glioblastoma -1.300 0.000
medulloblastoma, large-cell -1.100 0.003
pancreatic ductal adenocarcinoma liver m... -1.037 0.005
adult high grade glioma -1.400 0.001
subependymal giant cell astrocytoma -1.279 0.019
spina bifida -1.340 0.040

Synonym

Gene

PANTHER Protein Class (2)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (1)

PMID Text
24064143 Variation in the GFOD2 gene contributes to the genetic basis for a differential response to a cholesterol- or lipid-lowering diet.

AA Sequence

MKMLPGVGVFGTGSSARVLVPLLRAEGFTVEALWGKTEEEAKQLAEEMNIAFYTSRTDDILLHQDVDLVC      1 - 70
ISIPPPLTRQISVKALGIGKNVVCEKAATSVDAFRMVTASRYYPQLMSLVGNVLRFLPAFVRMKQLISEH     71 - 140
YVGAVMICDARIYSGSLLSPSYGWICDELMGGGGLHTMGTYIVDLLTHLTGRRAEKVHGLLKTFVRQNAA    141 - 210
IRGIRHVTSDDFCFFQMLMGGGVCSTVTLNFNMPGAFVHEVMVVGSAGRLVARGADLYGQKNSATQEELL    211 - 280
LRDSLAVGAGLPEQGPQDVPLLYLKGMVYMVQALRQSFQGQGDRRTWDRTPVSMAASFEDGLYMQSVVDA    281 - 350
IKRSSRSGEWEAVEVLTEEPDTNQNLCEALQRNNL                                       351 - 385
//

Text Mined References (11)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24064143 2013 Effect of a GFOD2 variant on responses in total and LDL cholesterol in Mexican subjects with hypercholesterolemia after soy protein and soluble fiber supplementation.
20864672 2010 Genetic variants influencing circulating lipid levels and risk of coronary artery disease.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...