Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.75
PubTator Score 2.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.400 7.8e-04
glioblastoma -1.300 6.0e-05
medulloblastoma, large-cell -1.100 2.8e-03
osteosarcoma -1.193 1.6e-06
pancreatic ductal adenocarcinoma liver m... -1.037 4.5e-03
psoriasis 1.300 2.9e-03
spina bifida -1.340 4.0e-02
subependymal giant cell astrocytoma -1.279 1.9e-02

Gene RIF (1)

AA Sequence

MKMLPGVGVFGTGSSARVLVPLLRAEGFTVEALWGKTEEEAKQLAEEMNIAFYTSRTDDILLHQDVDLVC      1 - 70
ISIPPPLTRQISVKALGIGKNVVCEKAATSVDAFRMVTASRYYPQLMSLVGNVLRFLPAFVRMKQLISEH     71 - 140
YVGAVMICDARIYSGSLLSPSYGWICDELMGGGGLHTMGTYIVDLLTHLTGRRAEKVHGLLKTFVRQNAA    141 - 210
IRGIRHVTSDDFCFFQMLMGGGVCSTVTLNFNMPGAFVHEVMVVGSAGRLVARGADLYGQKNSATQEELL    211 - 280
LRDSLAVGAGLPEQGPQDVPLLYLKGMVYMVQALRQSFQGQGDRRTWDRTPVSMAASFEDGLYMQSVVDA    281 - 350
IKRSSRSGEWEAVEVLTEEPDTNQNLCEALQRNNL                                       351 - 385
//

Text Mined References (11)

PMID Year Title