Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.68
PubTator Score 0.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
group 4 medulloblastoma 3.300 0.001
posterior fossa group B ependymoma 2.600 0.000
psoriasis -1.400 0.001

AA Sequence

MNDYKLEEDPVTKERTFKRFAPRKGDKIYQEFKKLYFYSDAYRPLKFACETIIEEYEDEISSLIAQETHY      1 - 70
LADKLCSEKSDLCETSANHTEL                                                     71 - 92
//

Text Mined References (6)

PMID Year Title
16488878 2006 Canopy1, a novel regulator of FGF signaling around the midbrain-hindbrain boundary in zebrafish.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.