Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.81
PubTator Score 0.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
group 4 medulloblastoma 3.300 1.1e-03
posterior fossa group B ependymoma 2.600 1.4e-04
psoriasis -1.400 1.1e-03

AA Sequence

MNDYKLEEDPVTKERTFKRFAPRKGDKIYQEFKKLYFYSDAYRPLKFACETIIEEYEDEISSLIAQETHY      1 - 70
LADKLCSEKSDLCETSANHTEL                                                     71 - 92
//

Text Mined References (6)

PMID Year Title