Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.13
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung cancer 4740 1.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Acrocephalosyndactylia 17 4.141 2.1

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer 1.600 1.0e-03

Protein-protein Interaction (4)

Gene RIF (1)

AA Sequence

MAAGCSEAPRPAAASDGSLVGQAGVLPCLELPTYAAACALVNSRYSCLVAGPHQRHIALSPRYLNRKRTG      1 - 70
IREQLDAELLRYSESLLGVPIAYDNIKVVGELGDIYDDQGHIHLNIEADFVIFCPEPGQKLMGIVNKVSS     71 - 140
SHIGCLVHGCFNASIPKPEQLSAEQWQTMEINMGDELEFEVFRLDSDAAGVFCIRGKLNITSLQFKRSEV    141 - 210
SEEVTENGTEEAAKKPKKKKKKKDPETYEVDSGTTKLADDADDTPMEESALQNTNNANGIWEEEPKKKKK    211 - 280
KKKHQEVQDQDPVFQGSDSSGYQSDHKKKKKKRKHSEEAEFTPPLKCSPKRKGKSNFL                281 - 338
//

Text Mined References (16)

PMID Year Title