Property Summary

NCBI Gene PubMed Count 29
Grant Count 10
Funding $1,934,079.75
PubMed Score 15.72
PubTator Score 18.32

Knowledge Summary

Patent (1,117)

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -3.095 0.000
cystic fibrosis 1.087 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
glioblastoma -1.300 0.001
group 4 medulloblastoma -1.300 0.002
medulloblastoma, large-cell -1.700 0.000
primitive neuroectodermal tumor -1.200 0.008
lung carcinoma -1.500 0.000

Synonym

Accession Q38SD2 Q6NVH5 Q6NYC0 Q6ZNL9 Q6ZNM9 Q96JN5 Q9H5S3
Symbols RIPK6
Roco1

Gene

  TechDev Info (1)

Jing-Ruey Yeh gRNA validated for zebrafish model, zebrafish mutant available

 Collection (1)

 GWAS Trait (1)

Gene RIF (15)

PMID Text
26192437 LRRK1 regulates mitotic spindle orientation downstream of PLK1 through CDK5RAP2-dependent centrosome maturation.
25413345 We find that LRRK1-mediated phosphorylation of CLIP-170 causes the accumulation of p150(Glued) (also known as DCTN1) a subunit of dynactin, at microtubule plus ends, thereby facilitating the migration of EGFR-containing endosomes.
24947832 LRRK1 carries out distinct functions from LRRK2 by interacting with different cellular proteins.
24241507 LRRK1 mutations may have a role in Parkinson's disease
22988872 The function of LRRK1 and both the physiological and the pathological roles of LRRK2 are only beginning to unfold.
22952686 purified and active LRRK1 and LRRK2 can form dimers in their full-length conformation
22337768 feedback down-regulation of LRRK1 kinase activity by EGFR plays an important role in the appropriate endosomal trafficking of EGFR
18272292 LRRK1 are active in the adult human cortex cerebri, hippocampus and also seen in the young human thymus.
18045479 LRRK1 genes encode low levels of expressed mRNA corresponding to low levels of protein during development.
17394548 mutations in LRRK2 are more prone to form inclusion bodies in transfected cells and are more toxic than equivalent mutations in LRRK1
More...

AA Sequence

MAGMSQRPPSMYWCVGPEESAVCPERAMETLNGAGDTGGKPSTRGGDPAARSRRTEGIRAAYRRGDRGGA      1 - 70
RDLLEEACDQCASQLEKGQLLSIPAAYGDLEMVRYLLSKRLVELPTEPTDDNPAVVAAYFGHTAVVQELL     71 - 140
ESLPGPCSPQRLLNWMLALACQRGHLGVVKLLVLTHGADPESYAVRKNEFPVIVRLPLYAAIKSGNEDIA    141 - 210
IFLLRHGAYFCSYILLDSPDPSKHLLRKYFIEASPLPSSYPGKTALRVKWSHLRLPWVDLDWLIDISCQI    211 - 280
TELDLSANCLATLPSVIPWGLINLRKLNLSDNHLGELPGVQSSDEIICSRLLEIDISSNKLSHLPPGFLH    281 - 350
LSKLQKLTASKNCLEKLFEEENATNWIGLRKLQELDISDNKLTELPALFLHSFKSLNSLNVSRNNLKVFP    351 - 420
DPWACPLKCCKASRNALECLPDKMAVFWKNHLKDVDFSENALKEVPLGLFQLDALMFLRLQGNQLAALPP    421 - 490
QEKWTCRQLKTLDLSRNQLGKNEDGLKTKRIAFFTTRGRQRSGTEAASVLEFPAFLSESLEVLCLNDNHL    491 - 560
DTVPPSVCLLKSLSELYLGNNPGLRELPPELGQLGNLWQLDTEDLTISNVPAEIQKEGPKAMLSYLRAQL    561 - 630
RKAEKCKLMKMIIVGPPRQGKSTLLEILQTGRAPQVVHGEATIRTTKWELQRPAGSRAKVESVEFNVWDI    631 - 700
GGPASMATVNQCFFTDKALYVVVWNLALGEEAVANLQFWLLNIEAKAPNAVVLVVGTHLDLIEAKFRVER    701 - 770
IATLRAYVLALCRSPSGSRATGFPDITFKHLHEISCKSLEGQEGLRQLIFHVTCSMKDVGSTIGCQRLAG    771 - 840
RLIPRSYLSLQEAVLAEQQRRSRDDDVQYLTDRQLEQLVEQTPDNDIKDYEDLQSAISFLIETGTLLHFP    841 - 910
DTSHGLRNLYFLDPIWLSECLQRIFNIKGSRSVAKNGVIRAEDLRMLLVGTGFTQQTEEQYFQFLAKFEI    911 - 980
ALPVANDSYLLPHLLPSKPGLDTHGMRHPTANTIQRVFKMSFVPVGFWQRFIARMLISLAEMDLQLFENK    981 - 1050
KNTKSRNRKVTIYSFTGNQRNRCSTFRVKRNQTIYWQEGLLVTFDGGYLSVESSDVNWKKKKSGGMKIVC   1051 - 1120
QSEVRDFSAMAFITDHVNSLIDQWFPALTATESDGTPLMEQYVPCPVCETAWAQHTDPSEKSEDVQYFDM   1121 - 1190
EDCVLTAIERDFISCPRHPDLPVPLQELVPELFMTDFPARLFLENSKLEHSEDEGSVLGQGGSGTVIYRA   1191 - 1260
RYQGQPVAVKRFHIKKFKNFANVPADTMLRHLRATDAMKNFSEFRQEASMLHALQHPCIVALIGISIHPL   1261 - 1330
CFALELAPLSSLNTVLSENARDSSFIPLGHMLTQKIAYQIASGLAYLHKKNIIFCDLKSDNILVWSLDVK   1331 - 1400
EHINIKLSDYGISRQSFHEGALGVEGTPGYQAPEIRPRIVYDEKVDMFSYGMVLYELLSGQRPALGHHQL   1401 - 1470
QIAKKLSKGIRPVLGQPEEVQFRRLQALMMECWDTKPEKRPLALSVVSQMKDPTFATFMYELCCGKQTAF   1471 - 1540
FSSQGQEYTVVFWDGKEESRNYTVVNTEKGLMEVQRMCCPGMKVSCQLQVQRSLWTATEDQKIYIYTLKG   1541 - 1610
MCPLNTPQQALDTPAVVTCFLAVPVIKKNSYLVLAGLADGLVAVFPVVRGTPKDSCSYLCSHTANRSKFS   1611 - 1680
IADEDARQNPYPVKAMEVVNSGSEVWYSNGPGLLVIDCASLEICRRLEPYMAPSMVTSVVCSSEGRGEEV   1681 - 1750
VWCLDDKANSLVMYHSTTYQLCARYFCGVPSPLRDMFPVRPLDTEPPAASHTANPKVPEGDSIADVSIMY   1751 - 1820
SEELGTQILIHQESLTDYCSMSSYSSSPPRQAARSPSSLPSSPASSSSVPFSTDCEDSDMLHTPGAASDR   1821 - 1890
SEHDLTPMDGETFSQHLQAVKILAVRDLIWVPRRGGDVIVIGLEKDSGAQRGRVIAVLKARELTPHGVLV   1891 - 1960
DAAVVAKDTVVCTFENENTEWCLAVWRGWGAREFDIFYQSYEELGRLEACTRKRR                  1961 - 2015
//

Text Mined References (30)

PMID Year Title
26192437 2015 PLK1-dependent activation of LRRK1 regulates spindle orientation by phosphorylating CDK5RAP2.
25413345 2015 LRRK1-phosphorylated CLIP-170 regulates EGFR trafficking by recruiting p150Glued to microtubule plus ends.
24947832 2014 Differential protein-protein interactions of LRRK1 and LRRK2 indicate roles in distinct cellular signaling pathways.
24510904 2014 Unbiased screen for interactors of leucine-rich repeat kinase 2 supports a common pathway for sporadic and familial Parkinson disease.
24241507 2014 Rare variants in LRRK1 and Parkinson's disease.
23291589 2013 Genome-wide association analyses identify multiple loci associated with central corneal thickness and keratoconus.
22988872 2012 Human leucine-rich repeat kinase 1 and 2: intersecting or unrelated functions?
22952686 2012 Biochemical characterization of highly purified leucine-rich repeat kinases 1 and 2 demonstrates formation of homodimers.
22899650 2012 LRRK2 functions as a Wnt signaling scaffold, bridging cytosolic proteins and membrane-localized LRP6.
22337768 2012 EGFR-dependent phosphorylation of leucine-rich repeat kinase LRRK1 is important for proper endosomal trafficking of EGFR.
More...