Property Summary

NCBI Gene PubMed Count 20
Grant Count 10
Funding $1,368,566.03
PubMed Score 11.45
PubTator Score 13.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma 2.700 0.003
ependymoma 3.500 0.010
oligodendroglioma 2.300 0.004
glioblastoma multiforme 1.500 0.000
group 4 medulloblastoma -4.500 0.000
medulloblastoma, large-cell -4.700 0.000
lung cancer 5.300 0.000
ovarian cancer -1.300 0.000
pituitary cancer -3.400 0.000
psoriasis -1.700 0.000

Gene RIF (5)

PMID Text
21084426 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19328558 Observational study of gene-disease association. (HuGE Navigator)
18218630 GPS2 interacts with RFX4_v3 to modulate transactivation of genes involved in brain morphogenesis, including Cx3Cl1
15940297 Observational study of gene-disease association. (HuGE Navigator)
15940297 The gene encoding the transcription factor RFX4 represents an excellent neurobiological and positional candidate gene for Bipolar disorder due to the potential involvement of RFX4 proteins in the regulation of circadian rhythms, linked to chromosome 12.

AA Sequence

MHCGLLEEPDMDSTESWIERCLNESENKRYSSHTSLGNVSNDENEEKENNRASKPHSTPATLQWLEENYE      1 - 70
IAEGVCIPRSALYMHYLDFCEKNDTQPVNAASFGKIIRQQFPQLTTRRLGTRGQSKYHYYGIAVKESSQY     71 - 140
YDVMYSKKGAAWVSETGKKEVSKQTVAYSPRSKLGTLLPEFPNVKDLNLPASLPEEKVSTFIMMYRTHCQ    141 - 210
RILDTVIRANFDEVQSFLLHFWQGMPPHMLPVLGSSTVVNIVGVCDSILYKAISGVLMPTVLQALPDSLT    211 - 280
QVIRKFAKQLDEWLKVALHDLPENLRNIKFELSRRFSQILRRQTSLNHLCQASRTVIHSADITFQMLEDW    281 - 350
RNVDLNSITKQTLYTMEDSRDEHRKLITQLYQEFDHLLEEQSPIESYIEWLDTMVDRCVVKVAAKRQGSL    351 - 420
KKVAQQFLLMWSCFGTRVIRDMTLHSAPSFGSFHLIHLMFDDYVLYLLESLHCQERANELMRAMKGEGST    421 - 490
AEVREEIILTEAAAPTPSPVPSFSPAKSATSVEVPPPSSPVSNPSPEYTGLSTTGAMQSYTWSLTYTVTT    491 - 560
AAGSPAENSQQLPCMRNTHVPSSSVTHRIPVYPHREEHGYTGSYNYGSYGNQHPHPMQSQYPALPHDTAI    561 - 630
SGPLHYAPYHRSSAQYPFNSPTSRMEPCLMSSTPRLHPTPVTPRWPEVPSANTCYTSPSVHSARYGNSSD    631 - 700
MYTPLTTRRNSEYEHMQHFPGFAYINGEASTGWAK                                       701 - 735
//

Text Mined References (24)

PMID Year Title
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
23583979 2013 Identification of heart rate-associated loci and their effects on cardiac conduction and rhythm disorders.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
21084426 2011 Genome-wide association study confirms BST1 and suggests a locus on 12q24 as the risk loci for Parkinson's disease in the European population.
19328558 2009 Case-control association study of 65 candidate genes revealed a possible association of a SNP of HTR5A to be a factor susceptible to bipolar disease in Bulgarian population.
18673564 2008 Identification and characterization of novel human tissue-specific RFX transcription factors.
18378158 2008 Immune transcriptome alterations in the temporal cortex of subjects with autism.
18218630 2008 G-protein pathway suppressor 2 (GPS2) interacts with the regulatory factor X4 variant 3 (RFX4_v3) and functions as a transcriptional co-activator.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17903297 2007 Genetic correlates of brain aging on MRI and cognitive test measures: a genome-wide association and linkage analysis in the Framingham Study.
More...