Property Summary

NCBI Gene PubMed Count 20
PubMed Score 12.81
PubTator Score 13.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma 2.700 3.0e-03
ependymoma 3.500 1.0e-02
glioblastoma multiforme 1.500 2.3e-12
group 3 medulloblastoma -1.500 2.0e-03
lung cancer 5.300 1.0e-06
medulloblastoma, large-cell -1.500 7.6e-04
oligodendroglioma 2.300 3.5e-03
ovarian cancer -1.300 1.6e-05
pituitary cancer -1.500 4.6e-03
psoriasis -1.700 4.2e-06

Gene RIF (5)

AA Sequence

MHCGLLEEPDMDSTESWIERCLNESENKRYSSHTSLGNVSNDENEEKENNRASKPHSTPATLQWLEENYE      1 - 70
IAEGVCIPRSALYMHYLDFCEKNDTQPVNAASFGKIIRQQFPQLTTRRLGTRGQSKYHYYGIAVKESSQY     71 - 140
YDVMYSKKGAAWVSETGKKEVSKQTVAYSPRSKLGTLLPEFPNVKDLNLPASLPEEKVSTFIMMYRTHCQ    141 - 210
RILDTVIRANFDEVQSFLLHFWQGMPPHMLPVLGSSTVVNIVGVCDSILYKAISGVLMPTVLQALPDSLT    211 - 280
QVIRKFAKQLDEWLKVALHDLPENLRNIKFELSRRFSQILRRQTSLNHLCQASRTVIHSADITFQMLEDW    281 - 350
RNVDLNSITKQTLYTMEDSRDEHRKLITQLYQEFDHLLEEQSPIESYIEWLDTMVDRCVVKVAAKRQGSL    351 - 420
KKVAQQFLLMWSCFGTRVIRDMTLHSAPSFGSFHLIHLMFDDYVLYLLESLHCQERANELMRAMKGEGST    421 - 490
AEVREEIILTEAAAPTPSPVPSFSPAKSATSVEVPPPSSPVSNPSPEYTGLSTTGAMQSYTWSLTYTVTT    491 - 560
AAGSPAENSQQLPCMRNTHVPSSSVTHRIPVYPHREEHGYTGSYNYGSYGNQHPHPMQSQYPALPHDTAI    561 - 630
SGPLHYAPYHRSSAQYPFNSPTSRMEPCLMSSTPRLHPTPVTPRWPEVPSANTCYTSPSVHSARYGNSSD    631 - 700
MYTPLTTRRNSEYEHMQHFPGFAYINGEASTGWAK                                       701 - 735
//

Text Mined References (24)

PMID Year Title