Property Summary

NCBI Gene PubMed Count 15
PubMed Score 8.56
PubTator Score 4.78

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.400 2.5e-05
breast carcinoma 1.500 8.4e-26
ductal carcinoma in situ 1.300 1.1e-02
glioblastoma -1.300 4.3e-03
group 3 medulloblastoma 1.200 6.6e-03
invasive ductal carcinoma 1.200 2.6e-02
medulloblastoma, large-cell -1.500 2.1e-03
osteosarcoma -1.589 4.4e-07
ovarian cancer 1.800 2.8e-04
pancreatic ductal adenocarcinoma liver m... -1.865 2.7e-02
Pick disease -1.100 1.6e-04
pituitary cancer 1.200 4.8e-06

 IMPC Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (5)

AA Sequence

MAASAHGSVWGPLRLGIPGLCCRRPPLGLYARMRRLPGPEVSGRSVAAASGPGAWGTDHYCLELLRKRDY      1 - 70
EGYLCSLLLPAESRSSVFALRAFNVELAQVKDSVSEKTIGLMRMQFWKKTVEDIYCDNPPHQPVAIELWK     71 - 140
AVKRHNLTKRWLMKIVDEREKNLDDKAYRNIKELENYAENTQSSLLYLTLEILGIKDLHADHAASHIGKA    141 - 210
QGIVTCLRATPYHGSRRKVFLPMDICMLHGVSQEDFLRRNQDKNVRDVIYDIASQAHLHLKHARSFHKTV    211 - 280
PVKAFPAFLQTVSLEDFLKKIQRVDFDIFHPSLQQKNTLLPLYLYIQSWRKTY                     281 - 333
//

Text Mined References (19)

PMID Year Title