Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.14
PubTator Score 4.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16010976 A novel human phosphatidic acid phosphatase type 2 isoform cDNAs (PAP2d) from the fetal brain cDNA library was cloned and characterized.

AA Sequence

MPLLPAALTSSMLYFQMVIMAGTVMLAYYFEYTDTFTVNVQGFFCHDSAYRKPYPGPEDSSAVPPVLLYS      1 - 70
LAAGVPVLVIIVGETAVFCLQLATRDFENQEKTILTGDCCYINPLVRRTVRFLGIYTFGLFATDIFVNAG     71 - 140
QVVTGNLAPHFLALCKPNYTALGCQQYTQFISGEEACTGNPDLIMRARKTFPSKEAALSVYAAMYLTMYI    141 - 210
TNTIKAKGTRLAKPVLCLGLMCLAFLTGLNRVAEYRNHWSDVIAGFLVGISIAVFLVVCVVNNFKGRQAE    211 - 280
NEHIHMDNLAQMPMISIPRVESPLEKVTSVQNHITAFAEVT                                 281 - 321
//

Text Mined References (12)

PMID Year Title
24903457 2014 Identification of a genetic variant at 2q12.1 associated with blood pressure in East Asians by genome-wide scan including gene-environment interactions.
23259602 2012 Genome-wide association scan of dental caries in the permanent dentition.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23064961 2013 GWAS of dental caries patterns in the permanent dentition.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20032306 2010 Plasticity-related gene 5 (PRG5) induces filopodia and neurite growth and impedes lysophosphatidic acid- and nogo-A-mediated axonal retraction.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16010976 2005 Cloning and characterization of a novel human phosphatidic acid phosphatase type 2, PAP2d, with two different transcripts PAP2d_v1 and PAP2d_v2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...