Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.5e-46
Disease Target Count Z-score Confidence
Heart disease 306 0.0 1.0

Synonym

Accession Q32Q52 F5H4P0
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (0)

AA Sequence

MEKTESFCPEVPPQDCGASPRPSLRSLPKNQGSLLQFDRQAPGRISTSPTLRRLRTRGCGTRQDAWQVTT      1 - 70
WGSWGAPVGFPCYLSKSLPGSPKDSSHLLSPLRLHSRLTSEPERALNAADSLEPQTRPTDKYLPPELQPV     71 - 140
NEGSLHQASLRQQEGHFLPSPTLRHPSPQGEELHPSRCVCIYFLRCYDIC                        141 - 190
//

Text Mined References (5)

PMID Year Title