Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 8.2e-05
ovarian cancer 8520 2.2e-04
sonic hedgehog group medulloblastoma 467 8.5e-04

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.396 8.2e-05
ovarian cancer -1.200 2.2e-04
sonic hedgehog group medulloblastoma 1.100 8.5e-04

AA Sequence

MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDA      1 - 70
AMNTTPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDR     71 - 140
GSGKKRGFAFVTFDDHDSVDKIVIQKYHTVKGHNCEVRKALPKQEMASASSSQRGRRGSGNFGGGRGDGF    141 - 210
GGNDNFGRGGNFSGRGGFGGSCGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGN    211 - 280
FGGRSSGPYGGGGQYFAKPQNQGGYGVSSSSSSYGSGRRF                                  281 - 320
//

Text Mined References (4)

PMID Year Title