Property Summary

NCBI Gene PubMed Count 7
PubMed Score 26.08
PubTator Score 13.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
acute myeloid leukemia -1.300 3.1e-03
acute quadriplegic myopathy 1.347 6.2e-06
Astrocytoma, Pilocytic 1.100 5.6e-07
atypical teratoid / rhabdoid tumor 1.300 8.7e-07
ependymoma 1.100 5.5e-11
glioblastoma 1.300 3.5e-07
group 3 medulloblastoma 1.400 1.1e-04
medulloblastoma, large-cell 1.500 6.7e-05
non-small cell lung cancer 1.028 3.3e-14
pediatric high grade glioma 1.100 8.1e-06

Gene RIF (4)

AA Sequence

MVLWILWRPFGFSGRFLKLESHSITESKSLIPVAWTSLTQMLLEAPGIFLLGQRKRFSTMPETETHERET      1 - 70
ELFSPPSDVRGMTKLDRTAFKKTVNIPVLKVRKEIVSKLMRSLKRAALQRPGIRRVIEDPEDKESRLIML     71 - 140
DPYKIFTHDSFEKAELSVLEQLNVSPQISKYNLELTYEHFKSEEILRAVLPEGQDVTSGFSRIGHIAHLN    141 - 210
LRDHQLSFKHLIGQVMIDKNPGITSAVNKINNIDNMYRNFQMEVLSGEQNMMTKVRENNYTYEFDFSKVY    211 - 280
WNPRLSTEHSRITELLKPGDVLFDVFAGVGPFAIPVAKKNCTVFANDLNPESHKWLLYNCKLNKVDQKVK    281 - 350
VFNLDGKDFLQGPVKEELMQLLGLSKERKPSVHVVMNLPAKAIEFLSAFKWLLDGQPCSSEFLPIVHCYS    351 - 420
FSKDANPAEDVRQRAGAVLGISLEACSSVHLVRNVAPNKEMLCITFQIPASVLYKNQTRNPENHEDPPLK    421 - 490
RQRTAEAFSDEKTQIVSNT                                                       491 - 509
//

Text Mined References (10)

PMID Year Title