Property Summary

NCBI Gene PubMed Count 7
Grant Count 5
R01 Count 5
Funding $1,310,514
PubMed Score 19.76
PubTator Score 13.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Synonym

Accession Q32P41 B2RN19 Q9P2F4
Symbols TRM5
COXPD26
KIAA1393

Gene

PANTHER Protein Class (2)

Gene RIF (4)

PMID Text
26189817 TRMT5 mutations cause a defect in post-transcriptional modification of mitochondrial tRNA associated with multiple respiratory-chain deficiencies.
23887145 Conservation of structure and mechanism by Trm5 enzymes
18187620 Knockdown of TRM5 tRNA methyltransferase 5 homolog (TRMT5) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
15248782 comparison of human TRM5 and E Coli TrmD activities, requirements for optimal activity, and tRNA methylation sites

AA Sequence

MVLWILWRPFGFSGRFLKLESHSITESKSLIPVAWTSLTQMLLEAPGIFLLGQRKRFSTMPETETHERET      1 - 70
ELFSPPSDVRGMTKLDRTAFKKTVNIPVLKVRKEIVSKLMRSLKRAALQRPGIRRVIEDPEDKESRLIML     71 - 140
DPYKIFTHDSFEKAELSVLEQLNVSPQISKYNLELTYEHFKSEEILRAVLPEGQDVTSGFSRIGHIAHLN    141 - 210
LRDHQLSFKHLIGQVMIDKNPGITSAVNKINNIDNMYRNFQMEVLSGEQNMMTKVRENNYTYEFDFSKVY    211 - 280
WNPRLSTEHSRITELLKPGDVLFDVFAGVGPFAIPVAKKNCTVFANDLNPESHKWLLYNCKLNKVDQKVK    281 - 350
VFNLDGKDFLQGPVKEELMQLLGLSKERKPSVHVVMNLPAKAIEFLSAFKWLLDGQPCSSEFLPIVHCYS    351 - 420
FSKDANPAEDVRQRAGAVLGISLEACSSVHLVRNVAPNKEMLCITFQIPASVLYKNQTRNPENHEDPPLK    421 - 490
RQRTAEAFSDEKTQIVSNT                                                       491 - 509
//

Text Mined References (10)

PMID Year Title
26189817 2015 TRMT5 Mutations Cause a Defect in Post-transcriptional Modification of Mitochondrial tRNA Associated with Multiple Respiratory-Chain Deficiencies.
23887145 2013 Conservation of structure and mechanism by Trm5 enzymes.
21269460 2011 Initial characterization of the human central proteome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15248782 2004 Isolation and characterization of the human tRNA-(N1G37) methyltransferase (TRM5) and comparison to the Escherichia coli TrmD protein.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.