Property Summary

NCBI Gene PubMed Count 24
PubMed Score 31.32
PubTator Score 24.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.500 8.9e-08
glioblastoma 1.200 2.3e-04
medulloblastoma, large-cell 1.100 9.4e-04
non-small cell lung cancer 1.132 2.4e-12
osteosarcoma 1.733 6.5e-03
ovarian cancer 1.900 5.0e-05
pituitary cancer -1.200 3.4e-07

Protein-protein Interaction (8)

Gene RIF (12)

AA Sequence

MAVRALKLLTTLLAVVAAASQAEVESEAGWGMVTPDLLFAEGTAAYARGDWPGVVLSMERALRSRAALRA      1 - 70
LRLRCRTQCAADFPWELDPDWSPSPAQASGAAALRDLSFFGGLLRRAACLRRCLGPPAAHSLSEEMELEF     71 - 140
RKRSPYNYLQVAYFKINKLEKAVAAAHTFFVGNPEHMEMQQNLDYYQTMSGVKEADFKDLETQPHMQEFR    141 - 210
LGVRLYSEEQPQEAVPHLEAALQEYFVAYEECRALCEGPYDYDGYNYLEYNADLFQAITDHYIQVLNCKQ    211 - 280
NCVTELASHPSREKPFEDFLPSHYNYLQFAYYNIGNYTQAVECAKTYLLFFPNDEVMNQNLAYYAAMLGE    281 - 350
EHTRSIGPRESAKEYRQRSLLEKELLFFAYDVFGIPFVDPDSWTPEEVIPKRLQEKQKSERETAVRISQE    351 - 420
IGNLMKEIETLVEEKTKESLDVSRLTREGGPLLYEGISLTMNSKLLNGSQRVVMDGVISDHECQELQRLT    421 - 490
NVAATSGDGYRGQTSPHTPNEKFYGVTVFKALKLGQEGKVPLQSAHLYYNVTEKVRRIMESYFRLDTPLY    491 - 560
FSYSHLVCRTAIEEVQAERKDDSHPVHVDNCILNAETLVCVKEPPAYTFRDYSAILYLNGDFDGGNFYFT    561 - 630
ELDAKTVTAEVQPQCGRAVGFSSGTENPHGVKAVTRGQRCAIALWFTLDPRHSERDRVQADDLVKMLFSP    631 - 700
EEMDLSQEQPLDAQQGPPEPAQESLSGSESKPKDEL                                      701 - 736
//

Text Mined References (27)

PMID Year Title