Property Summary

NCBI Gene PubMed Count 10
Grant Count 16
R01 Count 13
Funding $2,771,568.75
PubMed Score 2.20
PubTator Score 12.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma 1.300 0.023
oligodendroglioma 1.100 0.017
osteosarcoma 2.610 0.000
group 4 medulloblastoma 1.100 0.006
ovarian cancer 1.200 0.000
dermatomyositis 1.100 0.000

 GWAS Trait (1)

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAVAAAAAAGPVFWRRLLGLLPGRPGLAALLGRLSDRLGRNRDRQRRRSPWLLLAPLLSPAVPQVTSPPC      1 - 70
CLCPEGVHRFQWIRNLVPEFGVSSSHVRVLSSPAEFFELMKGQIRVAKRRVVMASLYLGTGPLEQELVDC     71 - 140
LESTLEKSLQAKFPSNLKVSILLDFTRGSRGRKNSRTMLLPLLRRFPEQVRVSLFHTPHLRGLLRLLIPE    141 - 210
RFNETIGLQHIKVYLFDNSVILSGANLSDSYFTNRQDRYVFLQDCAEIADFFTELVDAVGDVSLQLQGDD    211 - 280
TVQVVDGMVHPYKGDRAEYCKAANKRVMDVINSARTRQQMLHAQTFHSNSLLTQEDAAAAGDRRPAPDTW    281 - 350
IYPLIQMKPFEIQIDEIVTETLLTEAERGAKVYLTTGYFNLTQAYMDLVLGTRAEYQILLASPEVNGFFG    351 - 420
AKGVAGAIPAAYVHIERQFFSEVCSLGQQERVQLQEYWRRGWTFHAKGLWLYLAGSSLPCLTLIGSPNFG    421 - 490
YRSVHRDLEAQIAIVTENQALQQQLHQEQEQLYLRSGVVSSATFEQPSRQVKLWVKMVTPLIKNFF        491 - 556
//

Text Mined References (13)

PMID Year Title
24097068 2013 Discovery and refinement of loci associated with lipid levels.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11171073 2001 Purification of phosphatidylglycerophosphate synthase from Chinese hamster ovary cells.
More...