Property Summary

NCBI Gene PubMed Count 28
PubMed Score 38.76
PubTator Score 49.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 6.1962458451664E-27
breast carcinoma 1614 1.44784740693223E-18
juvenile dermatomyositis 1189 3.62479656889E-10
lung adenocarcinoma 2714 5.4942164063645E-10
ovarian cancer 8492 8.75305598238226E-10
lung carcinoma 2844 1.99784910949417E-9
ulcerative colitis 2087 3.66861034598399E-7
medulloblastoma, large-cell 6234 3.2469839893857E-5
tuberculosis and treatment for 3 months 327 7.31653984623532E-5
Breast cancer 3099 1.08467932138552E-4
psoriasis 6685 1.83492997793013E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 2.25340933327181E-4
Pick disease 1893 2.84545143881215E-4
pituitary cancer 1972 3.59374760455118E-4
osteosarcoma 7933 4.85461526076206E-4
acute quadriplegic myopathy 1157 0.00114296694154731
medulloblastoma 1524 0.00116652123140554
Amyotrophic Lateral Sclerosis 432 0.00119107477378093
invasive ductal carcinoma 2950 0.00125828966116532
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00131624391963503
oligodendroglioma 2849 0.0017451772937286
lung cancer 4473 0.00206656715553503
atypical teratoid / rhabdoid tumor 4369 0.00214607757016806
ependymoma 2514 0.00227994177619018
glioblastoma 5572 0.00251466883729796
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00288910637534729
pancreatic cancer 2300 0.00389297352469719
subependymal giant cell astrocytoma 2287 0.00483477379276673
astrocytic glioma 2241 0.00499085046122449
progressive supranuclear palsy 674 0.00646568931341386
diabetes mellitus 1663 0.00650571089716563
fascioscapulohumeral muscular dystrophy 100 0.00718796053825936
pediatric high grade glioma 2712 0.0090321014734707
gastric carcinoma 832 0.0211139395493762
acute myeloid leukemia 785 0.0225171735621023
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0257602676712624
hereditary spastic paraplegia 313 0.027714935759627
aldosterone-producing adenoma 664 0.0375799528078455
Disease Target Count Z-score Confidence
Obesity 616 0.0 1.0
Disease Target Count Z-score Confidence
Gingival recession 14 4.006 2.0

Expression

Synonym

Accession Q32MZ4 E9PGZ2 O75766 O75799 Q32MZ5 Q53T49 Q6PKG2 Q9Y607 LRR FLII-interacting protein 1
Symbols GCF2
TRIP
FLAP1
GCF-2
FLAP-1
HUFI-1
FLIIAP1

Gene

PDB

4H22  

  Ortholog (4)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (12)

PMID Text
26047573 Silencing of LRRFIP1 reverses the epithelial-mesenchymal transition via inhibition of the Wnt/beta-catenin signaling pathway.
24761896 High GCF2 expression is associated with hepatoma.
24690174 Higher baseline LRRFIP1 expression in human glioblastoma multiforme tissue (n=60) is associated with better prognosis upon later treatment with teniposide.
24567534 Data indicate that LRRFIP1 knockdown increased resting TNF mRNA level altered the ncRNA abundance at the LRRFIP1 binding region.
23505185 Eight SNPs (rs7575941, rs3769053, rs11689421, rs3820808, rs11680012, rs3806505, rs6739130, and rs11686141) showed evidence of association with at least two adiposity phenotypes and plasma levels of one marker of inflammation.
23099021 The FLI-interacting domain of LRRFIP1 forms a classic parallel, homodimeric coiled coil with 10 heptad repeats and 22 helical turns.
22750095 GCF2/LRRFIP1 plays an important role in colorectal cancer metastasis by regulating RhoA-induced cell adhesion.
21102652 LRRFIP1 is phosphorylated in response to immunologic stimuli and it is directed to lysosomal structures.
20833976 An association study of 6 of the 63 genes in 4235 cases and 6379 controls showed a putative association with myocardial infarction for COMMD7 (COMM domain-containing protein 7) and a major deviation from the null hypo thesis for LRRFIP1.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MTSPAAAQSREIDCLSPEAQKLAEARLAAKRAARAEAREIRMKELERQQKEEDSERYSRRSRRNTSASDE      1 - 70
DERMSVGSRGSLRVEERPEKDFTEKGSRNMPGLSAATLASLGGTSSRRGSGDTSISIDTEASIREIKELN     71 - 140
ELKDQIQDVEGKYMQGLKEMKDSLAEVEEKYKKAMVSNAQLDNEKTNFMYQVDTLKDMLLELEEQLAESR    141 - 210
RQYEEKNKEFEREKHAHSILQFQFAEVKEALKQREEMLEKHGIILNSEIATNGETSDTLNNVGYQGPTKM    211 - 280
TKEELNALKSTGDGTLGRASEVEVKNEIVANVGKREILHNTEKEQHTEDTVKDCVDIEVFPAGENTEDQK    281 - 350
SSEDTAPFLGTLAGATYEEQVQSQILESSSLPENTVQVESNEVMGAPDDRTRTPLEPSNCWSDLDGGNHT    351 - 420
ENVGEAAVTQVEEQAGTVASCPLGHSDDTVYHDDKCMVEVPQELETSTGHSLEKEFTNQEAAEPKEVPAH    421 - 490
STEVGRDHNEEEGEETGLRDEKPIKTEVPGSPAGTEGNCQEATGPSTVDTQNEPLDMKEPDEEKSDQQGE    491 - 560
ALDSSQKKTKNKKKKNKKKKSPVPVETLKDVKKELTYQNTDLSEIKEEEQVKSTDRKSAVEAQNEVTENP    561 - 630
KQKIAAESSENVDCPENPKIKLDGKLDQEGDDVQTAAEEVLADGDTLDFEDDTVQSSGPRAGGEELDEGV    631 - 700
AKDNAKIDGATQSSPAEPKSEDADRCTLPEHESPSQDISDACEAESTERCEMSEHPSQTVRKALDSNSLE    701 - 770
NDDLSAPGREPGHFNPESREDTRGGNEKGKSKEDCTMS                                    771 - 808
//

Text Mined References (38)

PMID Year Title
26047573 2015 Silencing of LRRFIP1 reverses the epithelial-mesenchymal transition via inhibition of the Wnt/?-catenin signaling pathway.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24761896 2014 Knockdown of GCF2/LRRFIP1 by RNAi causes cell growth inhibition and increased apoptosis in human hepatoma HepG2 cells.
24690174 2014 Higher LRRFIP1 expression in glioblastoma multiforme is associated with better response to teniposide, a type II topoisomerase inhibitor.
24567534 2014 Noncoding RNAs and LRRFIP1 regulate TNF expression.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23505185 2013 A variant in the LRRFIP1 gene is associated with adiposity and inflammation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...