Property Summary

NCBI Gene PubMed Count 15
PubMed Score 12.42
PubTator Score 10.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Breast cancer -1.900 1.7e-09
ductal carcinoma in situ 1.300 4.6e-02
Endometriosis -1.509 6.7e-03
esophageal adenocarcinoma -3.200 1.9e-02
interstitial cystitis -3.000 2.0e-03
lung adenocarcinoma 1.068 3.9e-02
nasopharyngeal carcinoma -2.500 4.3e-04
non primary Sjogren syndrome sicca 1.300 1.9e-02
non-small cell lung cancer 2.555 1.3e-11
pituitary cancer -1.500 1.8e-03
spina bifida -3.116 3.6e-02
urothelial carcinoma -1.800 2.9e-02

Gene RIF (8)

AA Sequence

MSLLKERKPKKPHYIPRPPGKPFKYKCFQCPFTCNEKSHLFNHMKYGLCKNSITLVSEQDRVPKCPKSNS      1 - 70
LDPKQTNQPDATAKPASSKSVANGLSAFDSKLQHSSAREDIKENLELQARGTHRCLGQKPALHRASPCKS     71 - 140
PAPEAALGAQPALEGAARPSAFVPVGEHRLKGPDNAEAPETLALHNPTAKAVSFHTKSAFHTPGYPWKAG    141 - 210
SPFLPPEFPHKISSTKGLGAISPYMHPTIPEYPPHFYTEHGLATIYSPYLLAGSSPECDAPLLSVYGTQD    211 - 280
PRHFLPHPGPIPKHLAPSPATYDHYRFFQQYPSNLPIPYGFYRPESAFSSYGLRLPPVTGLTRDQSSHLL    281 - 350
EEATLVYPASSPSRLNPSDPNRKHVEFESPIPEAKDSSKAGQRDTEGSKMSPRAGSAATGSPGRPSPTDF    351 - 420
MQTSQTCEGLYDLSNKAASSALGRLYPPEQSLTAFRPVKKSTECLPAQAAETTAESPVSLNVVNGDPPAP    421 - 490
TGSASLVSEAAPSSPDDSSGMGPLNLSKKSEINLAATHEPTYQGSPQAETASFSELQDLPLNLSVKDPCN    491 - 560
TQAPRPAFPGRPRAAEPAAAVPQKTGTEGSEDGPSHPETKPGSLDGDGAPPTGPGEEAPDACAVDSSEEQ    561 - 630
KQTAAVALCQLAAYSPRNIRVGDGDAAAPEPACRQDTPTLSSMESQEAQCDLRPKGQKRTSLRDAGKSQQ    631 - 700
GAKKAKLQDTARVFTLRRRARVS                                                   701 - 723
//

Text Mined References (16)

PMID Year Title