Property Summary

NCBI Gene PubMed Count 9
Grant Count 43
R01 Count 37
Funding $4,604,462.81
PubMed Score 91.67
PubTator Score 84.07

Knowledge Summary

Patent (4,695)

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.600 0.000
osteosarcoma -1.174 0.001
posterior fossa group B ependymoma 3.300 0.000
medulloblastoma, large-cell 1.200 0.002
facioscapulohumeral dystrophy 2.400 0.000
dermatomyositis 1.100 0.014

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (5)

PMID Text
24722904 This study demonstrates that cyclic stretch disrupts tight junctions and adherens junctions by a JNK2, c-Src, and MLCK-dependent mechanism.
23863751 Biochemical and physiological regulation of cardiac myocyte contraction by cardiac-specific myosin light chain kinase.
23591626 These findings suggest that hepatitis B virus X protein disrupts stress fiber formation and triggers apoptosis via an MLCK and a PTEN-dependent pathway.
18390750 data indicate that the IL-1beta-induced increase in MLCK protein expression and Caco-2 TJ permeability was mediated by an increase in MLCK expression and activity and by an NF-kappaB-dependent increase in MLCK gene transcription
17885681 Integrated cDNA expression analysis of failing human myocardia uncovered a novel protein kinase, cardiac-specific myosin light chain kinase (cardiac-MLCK), which acts on MLC2v.

AA Sequence

MSGTSKESLGHGGLPGLGKTCLTTMDTKLNMLNEKVDQLLHFQEDVTEKLQSMCRDMGHLERGLHRLEAS      1 - 70
RAPGPGGADGVPHIDTQAGWPEVLELVRAMQQDAAQHGARLEALFRMVAAVDRAIALVGATFQKSKVADF     71 - 140
LMQGRVPWRRGSPGDSPEENKERVEEEGGKPKHVLSTSGVQSDAREPGEESQKADVLEGTAERLPPIRAS    141 - 210
GLGADPAQAVVSPGQGDGVPGPAQAFPGHLPLPTKVEAKAPETPSENLRTGLELAPAPGRVNVVSPSLEV    211 - 280
APGAGQGASSSRPDPEPLEEGTRLTPGPGPQCPGPPGLPAQARATHSGGETPPRISIHIQEMDTPGEMLM    281 - 350
TGRGSLGPTLTTEAPAAAQPGKQGPPGTGRCLQAPGTEPGEQTPEGARELSPLQESSSPGGVKAEEEQRA    351 - 420
GAEPGTRPSLARSDDNDHEVGALGLQQGKSPGAGNPEPEQDCAARAPVRAEAVRRMPPGAEAGSVVLDDS    421 - 490
PAPPAPFEHRVVSVKETSISAGYEVCQHEVLGGGRFGQVHRCTEKSTGLPLAAKIIKVKSAKDREDVKNE    491 - 560
INIMNQLSHVNLIQLYDAFESKHSCTLVMEYVDGGELFDRITDEKYHLTELDVVLFTRQICEGVHYLHQH    561 - 630
YILHLDLKPENILCVNQTGHQIKIIDFGLARRYKPREKLKVNFGTPEFLAPEVVNYEFVSFPTDMWSVGV    631 - 700
ITYMLLSGLSPFLGETDAETMNFIVNCSWDFDADTFEGLSEEAKDFVSRLLVKEKSCRMSATQCLKHEWL    701 - 770
NNLPAKASRSKTRLKSQLLLQKYIAQRKWKKHFYVVTAANRLRKFPTSP                         771 - 819
//

Text Mined References (14)

PMID Year Title
24722904 2014 Cyclic stretch disrupts apical junctional complexes in Caco-2 cell monolayers by a JNK-2-, c-Src-, and MLCK-dependent mechanism.
23863751 2013 Biochemical and physiological regulation of cardiac myocyte contraction by cardiac-specific myosin light chain kinase.
23591626 2013 Hepatitis B virus X protein disrupts stress fiber formation and triggers apoptosis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
18390750 2008 Mechanism of IL-1beta-induced increase in intestinal epithelial tight junction permeability.
18202317 2008 Identification of cardiac-specific myosin light chain kinase.
17885681 2007 A cardiac myosin light chain kinase regulates sarcomere assembly in the vertebrate heart.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...