Property Summary

NCBI Gene PubMed Count 9
PubMed Score 91.67
PubTator Score 84.07

Knowledge Summary

Patent (4,695)

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 8.98672474751324E-8
malignant mesothelioma 3163 1.02540263741065E-4
facioscapulohumeral dystrophy 286 1.75785530371895E-4
osteosarcoma 7933 6.54056189526797E-4
medulloblastoma, large-cell 6234 0.00229723984630099
dermatomyositis 967 0.0142630757382386
Disease Target Count Z-score Confidence
Anthrax disease 3 3.176 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.600 0.000
osteosarcoma -1.174 0.001
posterior fossa group B ependymoma 3.300 0.000
medulloblastoma, large-cell 1.200 0.002
facioscapulohumeral dystrophy 2.400 0.000
dermatomyositis 1.100 0.014

Synonym

Accession Q32MK0 B5BUL9 B7Z5U8 Q32MK1 Q96DV1
Symbols MLCK
MLCK2
caMLCK

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (5)

PMID Text
24722904 This study demonstrates that cyclic stretch disrupts tight junctions and adherens junctions by a JNK2, c-Src, and MLCK-dependent mechanism.
23863751 Biochemical and physiological regulation of cardiac myocyte contraction by cardiac-specific myosin light chain kinase.
23591626 These findings suggest that hepatitis B virus X protein disrupts stress fiber formation and triggers apoptosis via an MLCK and a PTEN-dependent pathway.
18390750 data indicate that the IL-1beta-induced increase in MLCK protein expression and Caco-2 TJ permeability was mediated by an increase in MLCK expression and activity and by an NF-kappaB-dependent increase in MLCK gene transcription
17885681 Integrated cDNA expression analysis of failing human myocardia uncovered a novel protein kinase, cardiac-specific myosin light chain kinase (cardiac-MLCK), which acts on MLC2v.

AA Sequence

MSGTSKESLGHGGLPGLGKTCLTTMDTKLNMLNEKVDQLLHFQEDVTEKLQSMCRDMGHLERGLHRLEAS      1 - 70
RAPGPGGADGVPHIDTQAGWPEVLELVRAMQQDAAQHGARLEALFRMVAAVDRAIALVGATFQKSKVADF     71 - 140
LMQGRVPWRRGSPGDSPEENKERVEEEGGKPKHVLSTSGVQSDAREPGEESQKADVLEGTAERLPPIRAS    141 - 210
GLGADPAQAVVSPGQGDGVPGPAQAFPGHLPLPTKVEAKAPETPSENLRTGLELAPAPGRVNVVSPSLEV    211 - 280
APGAGQGASSSRPDPEPLEEGTRLTPGPGPQCPGPPGLPAQARATHSGGETPPRISIHIQEMDTPGEMLM    281 - 350
TGRGSLGPTLTTEAPAAAQPGKQGPPGTGRCLQAPGTEPGEQTPEGARELSPLQESSSPGGVKAEEEQRA    351 - 420
GAEPGTRPSLARSDDNDHEVGALGLQQGKSPGAGNPEPEQDCAARAPVRAEAVRRMPPGAEAGSVVLDDS    421 - 490
PAPPAPFEHRVVSVKETSISAGYEVCQHEVLGGGRFGQVHRCTEKSTGLPLAAKIIKVKSAKDREDVKNE    491 - 560
INIMNQLSHVNLIQLYDAFESKHSCTLVMEYVDGGELFDRITDEKYHLTELDVVLFTRQICEGVHYLHQH    561 - 630
YILHLDLKPENILCVNQTGHQIKIIDFGLARRYKPREKLKVNFGTPEFLAPEVVNYEFVSFPTDMWSVGV    631 - 700
ITYMLLSGLSPFLGETDAETMNFIVNCSWDFDADTFEGLSEEAKDFVSRLLVKEKSCRMSATQCLKHEWL    701 - 770
NNLPAKASRSKTRLKSQLLLQKYIAQRKWKKHFYVVTAANRLRKFPTSP                         771 - 819
//

Text Mined References (14)

PMID Year Title
24722904 2014 Cyclic stretch disrupts apical junctional complexes in Caco-2 cell monolayers by a JNK-2-, c-Src-, and MLCK-dependent mechanism.
23863751 2013 Biochemical and physiological regulation of cardiac myocyte contraction by cardiac-specific myosin light chain kinase.
23591626 2013 Hepatitis B virus X protein disrupts stress fiber formation and triggers apoptosis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
18390750 2008 Mechanism of IL-1beta-induced increase in intestinal epithelial tight junction permeability.
18202317 2008 Identification of cardiac-specific myosin light chain kinase.
17885681 2007 A cardiac myosin light chain kinase regulates sarcomere assembly in the vertebrate heart.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...