Property Summary

Ligand Count 6
NCBI Gene PubMed Count 9
PubMed Score 93.02
PubTator Score 84.07

Knowledge Summary

Patent (4,695)

Expression

  Differential Expression (6)

Disease log2 FC p
dermatomyositis 1.100 1.4e-02
ependymoma 1.300 1.3e-04
facioscapulohumeral dystrophy 2.400 1.8e-04
malignant mesothelioma 1.600 1.0e-04
medulloblastoma, large-cell 1.200 2.3e-03
osteosarcoma 1.132 4.5e-07

Protein-protein Interaction (2)

Gene RIF (5)

AA Sequence

MSGTSKESLGHGGLPGLGKTCLTTMDTKLNMLNEKVDQLLHFQEDVTEKLQSMCRDMGHLERGLHRLEAS      1 - 70
RAPGPGGADGVPHIDTQAGWPEVLELVRAMQQDAAQHGARLEALFRMVAAVDRAIALVGATFQKSKVADF     71 - 140
LMQGRVPWRRGSPGDSPEENKERVEEEGGKPKHVLSTSGVQSDAREPGEESQKADVLEGTAERLPPIRAS    141 - 210
GLGADPAQAVVSPGQGDGVPGPAQAFPGHLPLPTKVEAKAPETPSENLRTGLELAPAPGRVNVVSPSLEV    211 - 280
APGAGQGASSSRPDPEPLEEGTRLTPGPGPQCPGPPGLPAQARATHSGGETPPRISIHIQEMDTPGEMLM    281 - 350
TGRGSLGPTLTTEAPAAAQPGKQGPPGTGRCLQAPGTEPGEQTPEGARELSPLQESSSPGGVKAEEEQRA    351 - 420
GAEPGTRPSLARSDDNDHEVGALGLQQGKSPGAGNPEPEQDCAARAPVRAEAVRRMPPGAEAGSVVLDDS    421 - 490
PAPPAPFEHRVVSVKETSISAGYEVCQHEVLGGGRFGQVHRCTEKSTGLPLAAKIIKVKSAKDREDVKNE    491 - 560
INIMNQLSHVNLIQLYDAFESKHSCTLVMEYVDGGELFDRITDEKYHLTELDVVLFTRQICEGVHYLHQH    561 - 630
YILHLDLKPENILCVNQTGHQIKIIDFGLARRYKPREKLKVNFGTPEFLAPEVVNYEFVSFPTDMWSVGV    631 - 700
ITYMLLSGLSPFLGETDAETMNFIVNCSWDFDADTFEGLSEEAKDFVSRLLVKEKSCRMSATQCLKHEWL    701 - 770
NNLPAKASRSKTRLKSQLLLQKYIAQRKWKKHFYVVTAANRLRKFPTSP                         771 - 819
//

Text Mined References (14)

PMID Year Title