Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.88
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
active ulcerative colitis 1.844 2.1e-02
Chronic Lymphocytic Leukemia 1.846 4.9e-05
fibroadenoma 1.400 2.8e-02
lung adenocarcinoma 1.100 1.0e-02
osteosarcoma -1.819 6.0e-05
ovarian cancer 1.200 1.0e-02
pancreatic cancer -1.700 4.5e-03
pancreatic ductal adenocarcinoma liver m... 2.008 8.6e-03
subependymal giant cell astrocytoma 1.021 2.3e-02

Gene RIF (1)

AA Sequence

MEDAGEDPTTFAAHSLPSDPRLLATVTNAYLGTRVFHDTLHVSGVYNGAGGDTHRAMLPSPLNVRLEAPA      1 - 70
GMGEQLTETFALDTNTGSFLHTLEGPRFRASQCIYAHRTLPHVLAFRVSIARLAPGSGPITLLLRSAFSP     71 - 140
ESPDLDLHQGPDFQGARYLYGHTLTPEQPGGPQQEVHMLWTPAPPDLTLGEGEEARTWDFLTAVGGSQAE    141 - 210
AQACLTEALQLQARGALYTAHAQAWAQLWVECGLDVVGPLQLRQALRGSLYYLLSALPQPKAPGYICHGL    211 - 280
SPGGLSNGSREECYWGHVFWDQDLWMFPSILMFHPEAARAILEYRIRTLDGALENAQNLGYQGAKFAWES    281 - 350
ADSGLEVCPEDIYGVQEVHVNGAVVLAFELYYHTTQDLQLFREAGGWDVVRAVAEFWCSRVEWSPREEKY    351 - 420
HLRGVMSPDEYHSGVNNSVYTNVLVQNSLRFAAALAQDLGLPIPSQWLAVADKIKVPFDVEQNFHPEFDG    421 - 490
YEPGEVVKQADVVLLGYPVPFSLSPDVRRKNLEIYEAVTSPQGPAMTWSMFAVGWMELKDAVRARGLLDR    491 - 560
SFANMAEPFKVWTENADGSGAVNFLTGMGGFLQAVVFGCTGFRVTRAGVTFDPVCLSGISRVSVSGIFYQ    561 - 630
GNKLNFSFSEDSVTVEVTARAGPWAPHLEAELWPSQSRLSLLPGHKVSFPRSAGRIQMSPPKLPGSSSSE    631 - 700
FPGRTFSDVRDPLQSPLWVTLGSSSPTESLTVDPASE                                     701 - 737
//

Text Mined References (12)

PMID Year Title