Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.88
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
chronic lymphocytic leukemia 244 4.91661521578051E-5
osteosarcoma 7933 5.99734283881475E-5
pancreatic cancer 2300 0.00445911383118139
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00859832678451849
ovarian cancer 8492 0.0101692597894353
lung adenocarcinoma 2714 0.0104366288443462
active ulcerative colitis 477 0.0213698368083602
subependymal giant cell astrocytoma 2287 0.0226172822070456
fibroadenoma 557 0.0279008187085741

Expression

  Differential Expression (9)

Gene RIF (1)

PMID Text
19834535 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEDAGEDPTTFAAHSLPSDPRLLATVTNAYLGTRVFHDTLHVSGVYNGAGGDTHRAMLPSPLNVRLEAPA      1 - 70
GMGEQLTETFALDTNTGSFLHTLEGPRFRASQCIYAHRTLPHVLAFRVSIARLAPGSGPITLLLRSAFSP     71 - 140
ESPDLDLHQGPDFQGARYLYGHTLTPEQPGGPQQEVHMLWTPAPPDLTLGEGEEARTWDFLTAVGGSQAE    141 - 210
AQACLTEALQLQARGALYTAHAQAWAQLWVECGLDVVGPLQLRQALRGSLYYLLSALPQPKAPGYICHGL    211 - 280
SPGGLSNGSREECYWGHVFWDQDLWMFPSILMFHPEAARAILEYRIRTLDGALENAQNLGYQGAKFAWES    281 - 350
ADSGLEVCPEDIYGVQEVHVNGAVVLAFELYYHTTQDLQLFREAGGWDVVRAVAEFWCSRVEWSPREEKY    351 - 420
HLRGVMSPDEYHSGVNNSVYTNVLVQNSLRFAAALAQDLGLPIPSQWLAVADKIKVPFDVEQNFHPEFDG    421 - 490
YEPGEVVKQADVVLLGYPVPFSLSPDVRRKNLEIYEAVTSPQGPAMTWSMFAVGWMELKDAVRARGLLDR    491 - 560
SFANMAEPFKVWTENADGSGAVNFLTGMGGFLQAVVFGCTGFRVTRAGVTFDPVCLSGISRVSVSGIFYQ    561 - 630
GNKLNFSFSEDSVTVEVTARAGPWAPHLEAELWPSQSRLSLLPGHKVSFPRSAGRIQMSPPKLPGSSSSE    631 - 700
FPGRTFSDVRDPLQSPLWVTLGSSSPTESLTVDPASE                                     701 - 737
//

Text Mined References (12)

PMID Year Title
26682924 2016 Catalytic site of human protein-glucosylgalactosylhydroxylysine glucosidase: Three crucial carboxyl residues were determined by cloning and site-directed mutagenesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...