Property Summary

NCBI Gene PubMed Count 6
PubMed Score 19.26
PubTator Score 3.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Alcoholic Intoxication, Chronic 289
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

Gene RIF (3)

AA Sequence

MEEERKTAELQKNRIQDSVVFEDVAVDFTQEEWALLDLAQRNLYRDVMLENFQNLASLGYPLHTPHLISQ      1 - 70
WEQEEDLQTVKRELIQGIFMGEHREGFETQLKTNESVASQDICGEKISNEQKIVRFKRNDSWFSSLHENQ     71 - 140
ESCGIDYQNKSHERHLRNHMVENIYECYEENQDGQTFSQVPNLDSLKRNTEVKSCECHECGKAFVDHSSL    141 - 210
KSHIRSHTGSKPYQCKECGKAFHFLACFKKHMKTPTEEKPYECKECTKAFSCSSFFRAHMKIHIGKTNYE    211 - 280
CKECGKGFSCSSSLTEHKRIHSGDKPYECKECGKAFSCSSSLSKHKRIHSGDKPYECKECGKAFSSSSHL    281 - 350
IIHIRIHTGEKPYECKECGKAFSESSKLTVHGRTHTGEKPYKCKECGKAYNCPSSLSIHMRKHTGEKPYE    351 - 420
CLECGKAFYLPTSLNTHVKNQSREKPYECKECGKAFSCPSSFRAHVRDHTGKIQYECKECGKTFSRSSSL    421 - 490
TEHLRTHSGEKPYECKECGKAFISSSHLTVHIRTHTGEKPYECKKCGKAFIYPSALRIHMRTHTGEKPYE    491 - 560
CKECGKAFRHSSYLTVHARMHTGEKPFECLECGKAFSCPSSFRRHVRSHTGEKPYECKECGKAFVCPAYF    561 - 630
RRHVKTHTRENI                                                              631 - 642
//

Text Mined References (6)

PMID Year Title