Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.23
PubTator Score 4.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 5.74803101619447E-12
ovarian cancer 8492 1.15563526990159E-9
lung carcinoma 2844 5.02289167931581E-7
medulloblastoma, large-cell 6234 2.15662453726573E-6
adult high grade glioma 2148 2.37304655713803E-5
atypical teratoid / rhabdoid tumor 4369 3.06528288797523E-5
interstitial cystitis 2299 1.26714586509303E-4
medulloblastoma 1524 1.57242473863229E-4
Pick disease 1893 1.6057414171478E-4
pituitary cancer 1972 0.00220372500654415
primitive neuroectodermal tumor 3031 0.00368097222611512
subependymal giant cell astrocytoma 2287 0.0059329585451695
astrocytic glioma 2241 0.00695124003379915
glioblastoma 5572 0.00719504905310808
progressive supranuclear palsy 674 0.0233241212009165
aldosterone-producing adenoma 664 0.0329771652395621
Breast cancer 3099 0.0455058762945106
oligodendroglioma 2849 0.0456133011826639
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -2.000 0.007
posterior fossa group B ependymoma -2.800 0.000
oligodendroglioma -1.300 0.046
glioblastoma -2.000 0.007
medulloblastoma -2.200 0.000
atypical teratoid / rhabdoid tumor -2.900 0.000
medulloblastoma, large-cell -3.000 0.000
primitive neuroectodermal tumor -2.500 0.004
interstitial cystitis -2.900 0.000
adult high grade glioma -2.100 0.000
aldosterone-producing adenoma -1.447 0.033
subependymal giant cell astrocytoma -2.124 0.006
Breast cancer -1.200 0.046
lung carcinoma 1.600 0.000
Pick disease -1.600 0.000
progressive supranuclear palsy -1.300 0.023
ovarian cancer -1.300 0.000
pituitary cancer 2.500 0.002

Synonym

Accession Q32M45 Q8NAJ0 Q8NB39 Q8NB53
Symbols TMEM16D

Gene

  Ortholog (8)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

AA Sequence

MEASSSGITNGKTKVFHPEGGVDLQGYQLDMQILPDGPKSDVDFSEILNAIQEMAKDVNILFDELEAVSS      1 - 70
PCKDDDSLLHPGNLTSTSDDASRLEAGGETVPERNKSNGLYFRDGKCRIDYILVYRKSNPQTEKREVFER     71 - 140
NIRAEGLQMEKESSLINSDIIFVKLHAPWEVLGRYAEQMNVRMPFRRKIYYLPRRYKFMSRIDKQISRFR    141 - 210
RWLPKKPMRLDKETLPDLEENDCYTAPFSQQRIHHFIIHNKETFFNNATRSRIVHHILQRIKYEEGKNKI    211 - 280
GLNRLLTNGSYEAAFPLHEGSYRSKNSIRTHGAENHRHLLYECWASWGVWYKYQPLDLVRRYFGEKIGLY    281 - 350
FAWLGWYTGMLFPAAFIGLFVFLYGVTTLDHSQVSKEVCQATDIIMCPVCDKYCPFMRLSDSCVYAKVTH    351 - 420
LFDNGATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKKERMNPISGKPE    421 - 490
PYQAFTDKCSRLIVSASGIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWALIRNNSQVATTGTAVCINFC    491 - 560
IIMLLNVLYEKVALLLTNLEQPRTESEWENSFTLKMFLFQFVNLNSSTFYIAFFLGRFTGHPGAYLRLIN    561 - 630
RWRLEECHPSGCLIDLCMQMGIIMVLKQTWNNFMELGYPLIQNWWTRRKVRQEHGPERKISFPQWEKDYN    631 - 700
LQPMNAYGLFDEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPLASRAKDIGIW    701 - 770
YGILEGIGILSVITNAFVIAITSDFIPRLVYAYKYGPCAGQGEAGQKCMVGYVNASLSVFRISDFENRSE    771 - 840
PESDGSEFSGTPLKYCRYRDYRDPPHSLVPYGYTLQFWHVLAARLAFIIVFEHLVFCIKHLISYLIPDLP    841 - 910
KDLRDRMRREKYLIQEMMYEAELERLQKERKERKKNGKAHHNEWP                             911 - 955
//

Text Mined References (14)

PMID Year Title
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
24692353 2014 Structure and function of TMEM16 proteins (anoctamins).
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
22946059 2012 Anoctamins are a family of Ca2+-activated Cl- channels.
22302790 2012 The anoctamin (TMEM16) gene family: calcium-activated chloride channels come of age.
21642943 2011 Physiological roles and diseases of Tmem16/Anoctamin proteins: are they all chloride channels?
21607626 2011 Anoctamins.
19015192 2009 Anoctamin/TMEM16 family members are Ca2+-activated Cl- channels.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...