Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.23
PubTator Score 4.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -2.000 0.007
posterior fossa group B ependymoma -2.800 0.000
oligodendroglioma -1.300 0.046
glioblastoma -2.000 0.007
medulloblastoma -2.200 0.000
atypical teratoid / rhabdoid tumor -2.900 0.000
medulloblastoma, large-cell -3.000 0.000
primitive neuroectodermal tumor -2.500 0.004
interstitial cystitis -2.900 0.000
adult high grade glioma -2.100 0.000
aldosterone-producing adenoma -1.447 0.033
subependymal giant cell astrocytoma -2.124 0.006
Breast cancer -1.200 0.046
lung carcinoma 1.600 0.000
Pick disease -1.600 0.000
progressive supranuclear palsy -1.300 0.023
ovarian cancer -1.300 0.000
pituitary cancer 2.500 0.002

Synonym

Accession Q32M45 Q8NAJ0 Q8NB39 Q8NB53
Symbols TMEM16D

Gene

AA Sequence

MEASSSGITNGKTKVFHPEGGVDLQGYQLDMQILPDGPKSDVDFSEILNAIQEMAKDVNILFDELEAVSS      1 - 70
PCKDDDSLLHPGNLTSTSDDASRLEAGGETVPERNKSNGLYFRDGKCRIDYILVYRKSNPQTEKREVFER     71 - 140
NIRAEGLQMEKESSLINSDIIFVKLHAPWEVLGRYAEQMNVRMPFRRKIYYLPRRYKFMSRIDKQISRFR    141 - 210
RWLPKKPMRLDKETLPDLEENDCYTAPFSQQRIHHFIIHNKETFFNNATRSRIVHHILQRIKYEEGKNKI    211 - 280
GLNRLLTNGSYEAAFPLHEGSYRSKNSIRTHGAENHRHLLYECWASWGVWYKYQPLDLVRRYFGEKIGLY    281 - 350
FAWLGWYTGMLFPAAFIGLFVFLYGVTTLDHSQVSKEVCQATDIIMCPVCDKYCPFMRLSDSCVYAKVTH    351 - 420
LFDNGATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKKERMNPISGKPE    421 - 490
PYQAFTDKCSRLIVSASGIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWALIRNNSQVATTGTAVCINFC    491 - 560
IIMLLNVLYEKVALLLTNLEQPRTESEWENSFTLKMFLFQFVNLNSSTFYIAFFLGRFTGHPGAYLRLIN    561 - 630
RWRLEECHPSGCLIDLCMQMGIIMVLKQTWNNFMELGYPLIQNWWTRRKVRQEHGPERKISFPQWEKDYN    631 - 700
LQPMNAYGLFDEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPLASRAKDIGIW    701 - 770
YGILEGIGILSVITNAFVIAITSDFIPRLVYAYKYGPCAGQGEAGQKCMVGYVNASLSVFRISDFENRSE    771 - 840
PESDGSEFSGTPLKYCRYRDYRDPPHSLVPYGYTLQFWHVLAARLAFIIVFEHLVFCIKHLISYLIPDLP    841 - 910
KDLRDRMRREKYLIQEMMYEAELERLQKERKERKKNGKAHHNEWP                             911 - 955
//

Text Mined References (14)

PMID Year Title
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
24692353 2014 Structure and function of TMEM16 proteins (anoctamins).
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
22946059 2012 Anoctamins are a family of Ca2+-activated Cl- channels.
22302790 2012 The anoctamin (TMEM16) gene family: calcium-activated chloride channels come of age.
21642943 2011 Physiological roles and diseases of Tmem16/Anoctamin proteins: are they all chloride channels?
21607626 2011 Anoctamins.
19015192 2009 Anoctamin/TMEM16 family members are Ca2+-activated Cl- channels.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...