Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.25
PubTator Score 4.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -2.100 2.4e-05
aldosterone-producing adenoma -1.447 3.3e-02
astrocytic glioma -2.000 7.0e-03
atypical teratoid / rhabdoid tumor -1.100 8.1e-05
Breast cancer -1.200 4.6e-02
ependymoma -1.100 5.6e-03
glioblastoma -1.700 6.1e-05
group 4 medulloblastoma -1.500 8.1e-03
interstitial cystitis -1.100 9.7e-03
lung carcinoma 1.600 5.0e-07
medulloblastoma, large-cell -1.300 3.5e-04
oligodendroglioma -1.300 4.6e-02
ovarian cancer -1.300 1.2e-09
Pick disease -1.500 2.6e-05
pituitary cancer 2.200 9.1e-05
primitive neuroectodermal tumor -1.100 6.2e-03
progressive supranuclear palsy -1.200 1.0e-02
subependymal giant cell astrocytoma -1.178 5.9e-03

AA Sequence

MEASSSGITNGKTKVFHPEGGVDLQGYQLDMQILPDGPKSDVDFSEILNAIQEMAKDVNILFDELEAVSS      1 - 70
PCKDDDSLLHPGNLTSTSDDASRLEAGGETVPERNKSNGLYFRDGKCRIDYILVYRKSNPQTEKREVFER     71 - 140
NIRAEGLQMEKESSLINSDIIFVKLHAPWEVLGRYAEQMNVRMPFRRKIYYLPRRYKFMSRIDKQISRFR    141 - 210
RWLPKKPMRLDKETLPDLEENDCYTAPFSQQRIHHFIIHNKETFFNNATRSRIVHHILQRIKYEEGKNKI    211 - 280
GLNRLLTNGSYEAAFPLHEGSYRSKNSIRTHGAENHRHLLYECWASWGVWYKYQPLDLVRRYFGEKIGLY    281 - 350
FAWLGWYTGMLFPAAFIGLFVFLYGVTTLDHSQVSKEVCQATDIIMCPVCDKYCPFMRLSDSCVYAKVTH    351 - 420
LFDNGATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKKERMNPISGKPE    421 - 490
PYQAFTDKCSRLIVSASGIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWALIRNNSQVATTGTAVCINFC    491 - 560
IIMLLNVLYEKVALLLTNLEQPRTESEWENSFTLKMFLFQFVNLNSSTFYIAFFLGRFTGHPGAYLRLIN    561 - 630
RWRLEECHPSGCLIDLCMQMGIIMVLKQTWNNFMELGYPLIQNWWTRRKVRQEHGPERKISFPQWEKDYN    631 - 700
LQPMNAYGLFDEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPLASRAKDIGIW    701 - 770
YGILEGIGILSVITNAFVIAITSDFIPRLVYAYKYGPCAGQGEAGQKCMVGYVNASLSVFRISDFENRSE    771 - 840
PESDGSEFSGTPLKYCRYRDYRDPPHSLVPYGYTLQFWHVLAARLAFIIVFEHLVFCIKHLISYLIPDLP    841 - 910
KDLRDRMRREKYLIQEMMYEAELERLQKERKERKKNGKAHHNEWP                             911 - 955
//

Text Mined References (14)

PMID Year Title