Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
12600824 DEFB106 and DEFB109, were expressed in the lung.

AA Sequence

MRLHLLLLILLLFSILLSPVRGGLGPAEGHCLNLFGVCRTDVCNIVEDQIGACRRRMKCCRAWWILMPIP      1 - 70
TPLIMSDYQEPLKPNLK                                                          71 - 87
//

Text Mined References (4)

PMID Year Title
16033865 2005 Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
12734011 2003 Duplication and selection in the evolution of primate beta-defensin genes.
12600824 2003 ORFeome-based search of airway epithelial cell-specific novel human [beta]-defensin genes.
11854508 2002 Discovery of five conserved beta -defensin gene clusters using a computational search strategy.