Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.34
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Gene RIF (1)

AA Sequence

MKIQLFFFILHFWVTILPAKKKYPEYGSLDLRRECRIGNGQCKNQCHENEIRIAYCIRPGTHCCLQQ         1 - 67
//

Text Mined References (4)

PMID Year Title