Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.44
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
16033865 The encoded protein is thought to have antimicrobial activity.

AA Sequence

MKIQLFFFILHFWVTILPAKKKYPEYGSLDLRRECRIGNGQCKNQCHENEIRIAYCIRPGTHCCLQQ         1 - 67
//

Text Mined References (4)

PMID Year Title
16033865 2005 Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11854508 2002 Discovery of five conserved beta -defensin gene clusters using a computational search strategy.