Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.42
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Tonsillitis 16 4.051 2.0

Gene RIF (1)

AA Sequence

MKILCIFLTFVFTVSCGPSVPQKKTREVAERKRECQLVRGACKPECNSWEYVYYYCNVNPCCAVWEYQKP      1 - 70
IINKITSKLHQK                                                               71 - 82
//

Text Mined References (2)

PMID Year Title