Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.42
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Tonsillitis 18 4.027 2.0

Gene RIF (1)

PMID Text
16033865 The encoded protein is thought to display antimicrobial activity.

AA Sequence

MKILCIFLTFVFTVSCGPSVPQKKTREVAERKRECQLVRGACKPECNSWEYVYYYCNVNPCCAVWEYQKP      1 - 70
IINKITSKLHQK                                                               71 - 82
//

Text Mined References (2)

PMID Year Title
16033865 2005 Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
11854508 2002 Discovery of five conserved beta -defensin gene clusters using a computational search strategy.