Property Summary

NCBI Gene PubMed Count 4
PubMed Score 5.88
PubTator Score 3.71

Knowledge Summary

Patent

No data available

Gene RIF (2)

PMID Text
23482568 Human beta-defensin 114 regulates lipopolysaccharide (LPS)-mediated inflammation and protects sperm from motility loss. It also has antimicrobial activity against E. coli, S. aureus, and C. albicans.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MRIFYYLHFLCYVTFILPATCTLVNADRCTKRYGRCKRDCLESEKQIDICSLPRKICCTEKLYEEDDMF       1 - 69
//

Text Mined References (4)

PMID Year Title
23482568 2013 The novel human ?-defensin 114 regulates lipopolysaccharide (LPS)-mediated inflammation and protects sperm from motility loss.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16033865 2005 Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
11854508 2002 Discovery of five conserved beta -defensin gene clusters using a computational search strategy.