Property Summary

NCBI Gene PubMed Count 4
PubMed Score 3.71
PubTator Score 3.71

Knowledge Summary

Patent

No data available

Gene RIF (2)

AA Sequence

MRIFYYLHFLCYVTFILPATCTLVNADRCTKRYGRCKRDCLESEKQIDICSLPRKICCTEKLYEEDDMF       1 - 69
//

Text Mined References (4)

PMID Year Title