Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 1.1e-03
Disease Target Count Z-score Confidence
pulmonary tuberculosis 9 3.77 1.9

Gene RIF (1)

AA Sequence

MLPDHFSPLSGDIKLSVLALVVLVVLAQTAPDGWIRRCYYGTGRCRKSCKEIERKKEKCGEKHICCVPKE      1 - 70
KDKLSHIHDQKETSELYI                                                         71 - 88
//

Text Mined References (3)

PMID Year Title