Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Gene RIF (1)

PMID Text
16033865 The encoded protein is thought to display antimicrobial activity.

AA Sequence

MLPDHFSPLSGDIKLSVLALVVLVVLAQTAPDGWIRRCYYGTGRCRKSCKEIERKKEKCGEKHICCVPKE      1 - 70
KDKLSHIHDQKETSELYI                                                         71 - 88
//

Text Mined References (3)

PMID Year Title
16033865 2005 Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
11854508 2002 Discovery of five conserved beta -defensin gene clusters using a computational search strategy.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.