Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Gene RIF (1)

AA Sequence

MSVMKPCLMTIAILMILAQKTPGGLFRSHNGKSREPWNPCELYQGMCRNACREYEIQYLTCPNDQKCCLK      1 - 70
LSVKITSSKNVKEDYDSNSNLSVTNSSSYSHI                                           71 - 102
//

Text Mined References (3)

PMID Year Title