Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.50

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
16033865 The protein encoded by this gene is thought to display antimicrobial activity.

AA Sequence

MKLHSLISVLLLFVTLIPKGKTGVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYP      1 - 70
TPVPKGKSP                                                                  71 - 79
//

Text Mined References (3)

PMID Year Title
16421571 2006 DNA sequence and analysis of human chromosome 8.
16033865 2005 Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
11854508 2002 Discovery of five conserved beta -defensin gene clusters using a computational search strategy.