Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.50

Knowledge Summary

Patent

No data available

Synonym

Accession P0DP73 Q30KQ2
Symbols DEFB30
DEFB-30
DEFB130
DEFB130L

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Component (1)

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

MKLHSLISVLLLFVTLIPKGKTGVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYP      1 - 70
TPVPKGKSP                                                                  71 - 79
//

Text Mined References (4)

PMID Year Title