Property Summary

NCBI Gene PubMed Count 901
PubMed Score 2229.45
PubTator Score 2117.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count
Arthropathy 43
diabetes mellitus 1728
Hypogonadism 173
Abnormal glucose tolerance 1
Abnormality of the hypothalamus-pituitary axis 12
Alcohol abuse 50
Alopecia 115
Alzheimer's disease 658
Arthralgia 90
Ascites 22
Atrophy of testis 14
Autism Spectrum Disorders 75
Autosomal recessive predisposition 1442
Azoospermia 110
Calcium pyrophosphate deposition disease 13
Cardiac Arrhythmia 103
Cardiac conduction abnormalities 78
Cardiomegaly 116
Cardiomyopathies 110
Conduction disorder of the heart 79
Congestive heart failure 113
Decreased joint mobility 53
EKG abnormalities 78
Electrocardiogram abnormal 81
Electrocardiogram change 78
Elevated hepatic transaminases 81
Erectile dysfunction 32
Fatigue 182
Gynecomastia 64
HEMOCHROMATOSIS, TYPE 1 1
Heart failure 162
Hepatic enzyme increased 81
Hepatomegaly 285
Hyperferritinaemia 14
Hyperpigmentation 37
Hypogonadism, Isolated Hypogonadotropic 71
Hypogonadotropic hypogonadism 89
Increased ferritin 14
Increased hepatocellular carcinoma risk 27
Increased incidence of hepatocellular carcinoma 27
Liver Cirrhosis 181
Liver Dysfunction 99
Liver carcinoma 240
Liver enzymes abnormal 81
Liver function test increased 81
Liver function tests abnormal finding 81
MICROVASCULAR COMPLICATIONS OF DIABETES, SUSCEPTIBILITY TO, 7 (finding) 1
MYELODYSPLASTIC SYNDROME 53
Osteoporosis 363
Pleural effusion disorder 6
Porphyria Cutanea Tarda, Type I 1
Schizoaffective Disorder 55
Schizophrenia 1160
Serum ferritin increased 14
Serum iron raised 2
Spider Veins 17
Splenomegaly 190
Steatohepatitis 44
Subclinical abnormal liver function tests 81
Telangiectasis 36
Transaminases increased 81
menstrual periods stopped for over 6 months 13
Disease Target Count P-value
ovarian cancer 8520 2.5e-10
osteosarcoma 7950 9.2e-09
malignant mesothelioma 3232 2.2e-07
ependymoma 4679 7.4e-06
tuberculosis 2010 3.8e-05
psoriasis 6694 2.0e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Porphyria 10 0.0 5.0
X-linked sideroblastic anemia 4 0.0 5.0

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma 1.100 7.4e-06
malignant mesothelioma -2.200 2.2e-07
osteosarcoma 1.734 9.2e-09
ovarian cancer 1.100 2.5e-10
psoriasis 1.100 2.0e-04
tuberculosis 1.100 3.8e-05

 CSPA Cell Line (3)

Gene RIF (1011)

AA Sequence

MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEP      1 - 70
RTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGY     71 - 140
DGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLV    141 - 210
KVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRY    211 - 280
TCQVEHPGLDQPLIVIWEPSPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE      281 - 348
//

Text Mined References (904)

PMID Year Title