Property Summary

NCBI Gene PubMed Count 155
Grant Count 20
R01 Count 10
Funding $2,855,952.83
PubMed Score 450.94
PubTator Score 268.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
breast carcinoma 2.300 0.001
diabetes mellitus -1.600 0.008
lung carcinoma -2.500 0.000

 GO Function (1)

 MGI Term (1)

Gene RIF (111)

PMID Text
26740600 HLA-DRB5 affects type 1 diabetes risk and islet autoantibodies.
25365775 Brain DNA methylation in HLA-DRB5 was associated with pathological Alzheimer disease.
25240755 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
24505475 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
24366815 findings indicated that copy number variants of HLA-DRB5 was associated with the risk of systemic lupus erythematosus, and copy number deletion appeared to be protective for SLE.
23729440 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
23170932 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
23170932 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
23170932 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
23170932 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
More...

AA Sequence

MVCLKLPGGSYMAKLTVTLMVLSSPLALAGDTRPRFLQQDKYECHFFNGTERVRFLHRDIYNQEEDLRFD      1 - 70
SDVGEYRAVTELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPARTQTLQH     71 - 140
HNLLVCSVNGFYPGSIEVRWFRNSQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVT    141 - 210
SPLTVEWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYFKNQKGHSGLHPTGLVS                  211 - 266
//

Text Mined References (176)

PMID Year Title
26740600 2016 Next-Generation Sequencing Reveals That HLA-DRB3, -DRB4, and -DRB5 May Be Associated With Islet Autoantibodies and Risk for Childhood Type 1 Diabetes.
26085212 2015 Molecular mechanism and cellular function of MHCII ubiquitination.
25365775 2015 Association of Brain DNA methylation in SORL1, ABCA7, HLA-DRB5, SLC24A4, and BIN1 with pathological diagnosis of Alzheimer disease.
25186300 2014 Association between antinuclear antibodies and the HLA class II locus and heterogeneous characteristics of staining patterns: the Nagahama study.
25108386 2014 Genome-wide association analysis of Vogt-Koyanagi-Harada syndrome identifies two new susceptibility loci at 1p31.2 and 10q21.3.
24943344 2014 Frontotemporal dementia and its subtypes: a genome-wide association study.
24366815 2014 Copy number variations of HLA-DRB5 is associated with systemic lupus erythematosus risk in Chinese Han population.
24162737 2013 Meta-analysis of 74,046 individuals identifies 11 new susceptibility loci for Alzheimer's disease.
23850713 2014 Genome-wide association study of Crohn's disease in Koreans revealed three new susceptibility loci and common attributes of genetic susceptibility across ethnic populations.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
More...