Property Summary

NCBI Gene PubMed Count 157
PubMed Score 462.91
PubTator Score 268.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
breast carcinoma 2.300 1.2e-03
diabetes mellitus -1.600 7.6e-03
lung carcinoma -2.500 1.1e-08

 GO Function (1)

Protein-protein Interaction (3)

Gene RIF (108)

AA Sequence

MVCLKLPGGSYMAKLTVTLMVLSSPLALAGDTRPRFLQQDKYECHFFNGTERVRFLHRDIYNQEEDLRFD      1 - 70
SDVGEYRAVTELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPARTQTLQH     71 - 140
HNLLVCSVNGFYPGSIEVRWFRNSQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVT    141 - 210
SPLTVEWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYFKNQKGHSGLHPTGLVS                  211 - 266
//

Text Mined References (178)

PMID Year Title